Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Cyclic Peptides  >   Disulfide Cyclized Peptides  >>  hBD-3, β-Defensin-3, human

Product Name hBD - 3, β - Defensin - 3, human
GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: 11 - 40, 18 - 33, 23 - 41)
Size 0.1 mg
Catalog # AS-60741
US$ $303
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Datasheet
Storage -20C
References Dhople, V. et al. Biochim. Biophys. Acta 1758, 1499 (2006); Cole, A. Protein and Peptide Letters 12, 41 (2005).
Molecular Weight 5155.2
Sequence
(One-Letter Code)
GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: 11-40, 18-33, 23-41)
Sequence
(Three-Letter Code)
H - Gly - Ile - Ile - Asn - Thr - Leu - Gln - Lys - Tyr - Tyr - Cys - Arg - Val - Arg - Gly - Gly - Arg - Cys - Ala - Val - Leu - Ser - Cys - Leu - Pro - Lys - Glu - Glu - Gln - Ile - Gly - Lys - Cys - Ser - Thr - Arg - Gly - Arg - Lys - Cys - Cys - Arg - Arg - Lys - Lys - OH (Disulfide bridge: 11 - 40, 18 - 33, 23 - 41)
Product Citations Davis, SE. et al. (2014). Masking of β(1-3)-Glucan in the Cell Wall of Candida albicans from Detection by Innate Immune Cells Depends on Phosphatidylserine. Infect Immun 82, 4405. doi: 10.1128/IAI.01612-14.
     
  < Back