Peptides  >  GPCR Peptide Ligands  >  Glucagon
 Product Size Catalog # US$  
[FAM - Trp31] - GLP - 1 (7 - 36), Fluorescent label at Trp31
HAEGTFTSDVSSYLEGQAAKEFIA (Trp - S - FAM) - LVKGR - NH2
0.5 mg AS-64488 $357
Biotin - Glucagon (1 - 29), bovine, human, porcine
Biotin - HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
0.5 mg AS-60274-05 $143
Biotin - Glucagon (1 - 29), bovine, human, porcine
Biotin - HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
1 mg AS-60274-1 $242
Biotin - Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human
Biotin - HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
0.5 mg AS-23586 $198
GLP - 1(9 - 36), amide, human
EGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
1 mg AS-65070 $203
GLP - 2 (1 - 34), Glucagon - Like Peptide - 2 (1 - 34), human
HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
1 mg AS-62068 $297
Glucagon (1 - 18)
HSQGTFTSDYSKYLDSRR
1 mg AS-64344-1 $110
Glucagon (1 - 29), bovine, human, porcine
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
0.5 mg AS-22456 $71
Glucagon (1 - 29), bovine, human, porcine
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
1 mg AS-22457 $127
Glucagon (1 - 29), bovine, human, porcine, FAM - labeled
FAM - HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
0.5 mg AS-60273-05 $143
Glucagon (1 - 29), bovine, human, porcine, FAM - labeled
FAM - HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
1 mg AS-60273-1 $242
Glucagon (1 - 37), Oxyntomodulin, porcine
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
1 mg AS-22455 $665
Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
0.5 mg AS-22462 $127
Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
1 mg AS-22463 $231
Glucagon - Like Peptide 1, GLP - 1 (7 - 36) - Lys(Biotin), amide, human
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin) - NH2
0.5 mg AS-23642 $275
Glucagon - Like Peptide 1, GLP - 1 (7 - 36) - Lys(Biotin), amide, human
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin) - NH2
1 mg AS-23643 $457
Glucagon - Like Peptide 1, GLP - 1 (7 - 37)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
0.5 mg AS-20761 $154
Glucagon - Like Peptide 1, GLP - 1 (7 - 37)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
1 mg AS-20762 $275
Glucagon - Like Peptide 1, GLP - 1 amide, human
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
0.5 mg AS-22460 $181
Glucagon - Like Peptide 1, GLP - 1 amide, human
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
1 mg AS-22461 $335
Glucagon - Like Peptide 1, GLP - 1 amide, human, FAM - labeled
FAM - HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
0.5 mg AS-23606 $291
Glucagon - Like Peptide 1, GLP - 1 amide, human, FAM - labeled
FAM - HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
1 mg AS-23607 $484
Glucagon - like Peptide - 2, GLP - 2 (146 - 178), human
HADGSFSDEMNTILDNLAARDFINWLIQTKITD
1 mg AS-62070 $281
  < Back