Peptides  >  Calcitonin Related Peptides
Calcitonin gene-related peptide (CGRP), adrenomedullin (ADM) and amylin belong to a unique group of calcitonin-related peptide hormones important for homeostasis in diverse tissues. Calcitonin, a 32-amino acid peptide hormone, is essential for calcium balance, whereas CGRP and ADM are important for neurotransmission and cardiovascular and respiratory function. Calcitonin regulates mineral balance by controlling blood concentrations of calcium and phosphorus metabolism and can cause hypercalcemia. An increase in the serum calcium level is known to stimulate calcitonin secretion. In mammals, the major source of calcitonin is from the parafollicular or C cells in the thyroid gland, but it is also synthesized in a wide variety of other tissues, including the lung and intestinal tract. Calcitonin contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring. The calcitonin family of peptides act through G-protein protein coupled membrane receptors.

Ref: Roh, J. et al. J. Biol. Chem. 279, 7264 (2004); Rossi, S. et al. J. Biol. Chem. 278, 24994 (2003); Roesser, JR. et al. J. Biol. Chem. 268, 8366 (1993); Leonard, M. et al. J. Biol. Chem. 278, 40296 (2003); Cote, GJ. and RF. Gagel, J. Biol. Chem. 261, 15524 (1986); Felsenfeld, A. et al. J. Kidney Dis. 21, 292 (1993).
 Product Size Catalog # US$  
α - Calcitonin Gene Related Peptide, α - CGRP, rat
SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF - NH2 (Disulfide bridge: 2 - 7)
SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF - NH2 (Disulfide bridge: 2 - 7)
1 mg 60730 $259
α - CGRP (19 - 37), human
SGGVVKNNFVPTNVGSKAF - NH2
SGGVVKNNFVPTNVGSKAF - NH2
1 mg 61116 $132
β - CGRP, human
ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF - NH2 (Disulfide bridge:2 - 7)
ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF - NH2 (Disulfide bridge:2 - 7)
1 mg 64563-1 $330
β - CGRP, human
ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF - NH2 (Disulfide bridge:2 - 7)
ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF - NH2 (Disulfide bridge:2 - 7)
0.5 mg 64563-05 $198
Biotin - a - CGRP, human
Biotin - LC - ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2 (Disulfide bridge:2 - 7)
Biotin - LC - ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSK
AF - NH2 (Disulfide bridge:2 - 7)
1 mg 64564-1 $750
Biotin - Calcitonin, human
Biotin - CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP - NH2 (Disulfide bridge: 1 - 7)
Biotin - CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP - NH2 (Disulfide bridge: 1 - 7)
0.5 mg 23580 $303
Calcitonin Gene Related Peptide, CGRP (8 - 37), human
VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2
VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2
0.5 mg 22856 $121
Calcitonin Gene Related Peptide, CGRP (8 - 37), human
VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2
VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2
1 mg 22857 $215
Calcitonin Gene Related Peptide, CGRP (8 - 37), rat
VTHRLAGLLSRSGGVVKDNFVPTNVGSEAF - NH2
VTHRLAGLLSRSGGVVKDNFVPTNVGSEAF - NH2
1 mg 62956 $237
Calcitonin Gene Related Peptide, CGRP, human
ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2 (Disulfide bridge: 2 - 7)
ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2 (Disulfide bridge: 2 - 7)
0.5 mg 20681 $154
Calcitonin Gene Related Peptide, CGRP, human
ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2 (Disulfide bridge: 2 - 7)
ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2 (Disulfide bridge: 2 - 7)
1 mg 20682 $259
Calcitonin N - Terminal Flanking Peptide, human, N - Procalcitonin
APFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQEREGSSLDSPRS
APFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQ
EREGSSLDSPRS
1 mg 20680 $577
Calcitonin, human
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP - NH2 (Disulfide bridge: 1 - 7)
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP - NH2 (Disulfide bridge: 1 - 7)
1 mg 20673 $137
Calcitonin, human
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP - NH2 (Disulfide bridge: 1 - 7)
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP - NH2 (Disulfide bridge: 1 - 7)
5 mg 20674 $577
Calcitonin, rat
CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP - NH2 (Disulfide bridge: 1 - 7)
CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP - NH2 (Disulfide bridge: 1 - 7)
5 mg 24205 $577
Calcitonin, salmon
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP - NH2 (Disulfide bridge: 1 - 7)
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP - NH2 (Disulfide bridge: 1 - 7)
1 mg 20677 $121
Calcitonin, salmon
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP - NH2 (Disulfide bridge: 1 - 7)
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP - NH2 (Disulfide bridge: 1 - 7)
5 mg 20678 $484
  < Back