Calcitonin Related Peptides

Account Login

My Cart

My Custom Reports

My Favorites

Logout

Peptides > Calcitonin Related Peptides

Calcitonin gene-related peptide (CGRP), adrenomedullin (ADM) and amylin belong to a unique group of calcitonin-related peptide hormones important for homeostasis in diverse tissues. Calcitonin, a 32-amino acid peptide hormone, is essential for calcium balance, whereas CGRP and ADM are important for neurotransmission and cardiovascular and respiratory function. Calcitonin regulates mineral balance by controlling blood concentrations of calcium and phosphorus metabolism and can cause hypercalcemia. An increase in the serum calcium level is known to stimulate calcitonin secretion. In mammals, the major source of calcitonin is from the parafollicular or C cells in the thyroid gland, but it is also synthesized in a wide variety of other tissues, including the lung and intestinal tract. Calcitonin contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring. The calcitonin family of peptides act through G-protein protein coupled membrane receptors.

Ref: Roh, J. et al. J. Biol. Chem. 279, 7264 (2004); Rossi, S. et al. J. Biol. Chem. 278, 24994 (2003); Roesser, JR. et al. J. Biol. Chem. 268, 8366 (1993); Leonard, M. et al. J. Biol. Chem. 278, 40296 (2003); Cote, GJ. and RF. Gagel, J. Biol. Chem. 261, 15524 (1986); Felsenfeld, A. et al. J. Kidney Dis. 21, 292 (1993).

Product	Size	Catalog #	US$
α - Calcitonin Gene Related Peptide, α - CGRP, rat SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF - NH2 (Disulfide bridge: 2 - 7)	1 mg	60730	$259

α - CGRP (19 - 37), human SGGVVKNNFVPTNVGSKAF - NH2	1 mg	61116	$132

β - CGRP, human ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF - NH2 (Disulfide bridge:2 - 7)	1 mg	64563-1	$330

β - CGRP, human ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF - NH2 (Disulfide bridge:2 - 7)	0.5 mg	64563-05	$198

Biotin - a - CGRP, human Biotin - LC - ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSK AF - NH2 (Disulfide bridge:2 - 7)	1 mg	64564-1	$750

Biotin - Calcitonin, human Biotin - CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP - NH2 (Disulfide bridge: 1 - 7)	0.5 mg	23580	$303

Calcitonin Gene Related Peptide, CGRP (8 - 37), human VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2	0.5 mg	22856	$121

Calcitonin Gene Related Peptide, CGRP (8 - 37), human VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2	1 mg	22857	$215

Calcitonin Gene Related Peptide, CGRP (8 - 37), rat VTHRLAGLLSRSGGVVKDNFVPTNVGSEAF - NH2	1 mg	62956	$237

Calcitonin Gene Related Peptide, CGRP, human ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2 (Disulfide bridge: 2 - 7)	0.5 mg	20681	$154

Calcitonin Gene Related Peptide, CGRP, human ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2 (Disulfide bridge: 2 - 7)	1 mg	20682	$259

Calcitonin N - Terminal Flanking Peptide, human, N - Procalcitonin APFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQ EREGSSLDSPRS	1 mg	20680	$577

Calcitonin, human CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP - NH2 (Disulfide bridge: 1 - 7)	1 mg	20673	$137

Calcitonin, human CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP - NH2 (Disulfide bridge: 1 - 7)	5 mg	20674	$577

Calcitonin, rat CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP - NH2 (Disulfide bridge: 1 - 7)	5 mg	24205	$577

Calcitonin, salmon CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP - NH2 (Disulfide bridge: 1 - 7)	1 mg	20677	$121

Calcitonin, salmon CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP - NH2 (Disulfide bridge: 1 - 7)	5 mg	20678	$484

< Back