Peptides  >  HIV Related Peptides
Over 5000 HIV-related peptides have been synthesized and inventoried at AnaSpec. These include HIV-1 MN strain, glycoprotein 160 (gp160), gp120W16D, MN envelope (env) consensus B tat, consensus B VIF, HXB2 gag, SIVmac239, SIVmac239env, SIVmac239 gag. Most of these peptides are 15-mers or 20-mers, with overlaps between sequential peptides. Documentation includes HPLC and MS data, with peptide purity generally at >90% pure.
 Product Size Catalog # US$  
Biotin - TAT (47 - 57)
Biotin - YGRKKRRQRRR
1 mg 61209 $115
C34, gp41 HIV Fragment
WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL
1 mg 62101 $297
Cys(Npys) - TAT (47 - 57)
C(Npys)YGRKKRRQRRR - NH2
1 mg 61214 $242
Cys(Npys) - TAT (47 - 57), FAM - labeled
C(Npys)YGRKKRRQRRR - K(FAM) - NH2
1 mg 61213 $291
Cys - TAT (47 - 57)
CYGRKKRRQRRR - NH2
1 mg 61212 $99
FITC - beta - Ala - NYAD - 1 (NYAD - 2)
FITC - (beta - A) - ITFXDLLXYYGP - NH2 (with special cyclization to get double bond, X= (S) - alpha - (2’ - pentenyl)alanine)
0.25 mg 63733-025 $423
FITC - LC - TAT (47 - 57)
FITC - LC - YGRKKRRQRRR - NH2
0.5 mg 27042 $154
FITC - LC - TAT (47 - 57)
FITC - LC - YGRKKRRQRRR - NH2
1 mg 27043 $242
Gag Spacer Peptide P1
HHHHHHIIKIIK
1 mg 64773 $66
HIV Protease FRET Substrate I 1 mg 22992 $231
HIV Substrate
KARVNleF(4 - NO2)EANle - NH2
1 mg 24286 $66
HIV Substrate, HiLyte™ Fluor 488
QXL® 520 - GABA - SQNYPIVQ - K(HiLyte™ Fluor 488) - NH2
0.1 mg 60635 $115
HIV - 1 Protease Substrate, chromogenic
Ac - RKILF(4 - NO2)LDG - NH2
5 mg 22089 $242
NYAD - 1
ITFXDLLXYYGP - NH2 (with special cyclization to get double bond, X= (S) - alpha - (2’ - pentenyl)alanine)
1 mg 63734-1 $423
Prostatic Acid Phosphatase (248 - 286), PAP (248 - 286)
GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY
1 mg 64518 $330
R9 - Tat
GRRRRRRRRRPPQ
1 mg 64209 $83
T20
Ac - YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF - NH2
1 mg 61235 $363
TAT (47 - 57)
YGRKKRRQRRR
1 mg 60023-1 $93
TAT (47 - 57)
YGRKKRRQRRR
5 mg 60023-5 $363
TAT (47 - 57) GGG - Cys(Npys)
YGRKKRRQRRRGGG - C(Npys) - NH2
1 mg 61215 $242
TAT (47 - 57), FAM - labeled
FAM - YGRKKRRQRRR
1 mg 61210 $203
TAT (47 - 57), TAMRA - labeled
TAMRA - YGRKKRRQRRR
1 mg 61211 $231
Tat FRET Peptide for RNA Binding Assays
5 - FAM - AAARKKRRQRRRAAAC(TAMRA - Mal) - NH2
0.5 mg 64346-05 $423
  < Back