Peptides  >  Antimicrobial and Related Peptides
Cationic antimicrobial peptides are important components of the innate defenses of all species. More than 100 of these peptides have been identified in numerous organisms, including fungi, insects, amphibians and humans. These hydrophobic and amphipathic peptides exhibit antibiotic, fungicidal, hemolytic, virucidal, and tumoricidal activities. Based on their structural properties, these antimicrobial peptides can be grouped into three classes, peptides that are helicoidal, peptides containing one to several disulfide bridges and peptides rich in certain amino acids such as proline or tryptophan. Most of these peptides share some common characteristics, such as their low molecular mass (2–5 kDa), the presence of multiple lysine and arginine residues and an amphipathic nature. Although the exact mechanism by which they kill bacteria is not clearly understood, it has been shown that peptide–lipid interactions leading to membrane permeation play a role in their activity. Examples of antibiotic peptides include magainins, secreted by the skin of Xenopus laevis; defensins from the human neutrophils and histatins from human saliva. Cecropins are produced by insects under conditions of infections. Cecropins A, B, and D are close homologues consisting of 35-39 residues found in the pupae of the cecropin moth.

Ref: Won, H. et al. Eur. J. Biochem. 269, 4367 (2002); Hancock, REW. and MG. Scott, Proc. Natl. Acad. Sci. USA 97, 8856 (2000); Andreu, D. et al. Proc. Natl. Acad. Sci. USA 80, 6475 (1983); M. Vaara and T. Vaara, Antimicrob. Agents Chemo. 38, 2498 (1994); Vizioli J. et al. Insect. Mol. Biol. 9, 75 (2000); Silvestro, L. et al. Antimicrob. Agents Chemo. 44, 602 (2000); Helmerhorst, E. et al. J. Biol. Chem. 274, 7286 (1999).
 Product Size Catalog # US$  
5 - FAM - LC - LL - 37
5 - FAM - LC - [LL-37, 37 aa]
5 - FAM - LC - LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTE
S
0.1 mg 63694 $132
Ac - Lys(Ac) - D - Ala - D - Ala - OH
Ac - Lys(Ac) - aa
Ac - Lys(Ac) - aa
50 mg 64561 $220
Apidaecin IB
GNNRPVYIPQPRPPHPRL
GNNRPVYIPQPRPPHPRL
1 mg 62044 $110
Aurein 1.1
GLFDIIKKIAESI - NH2
GLFDIIKKIAESI - NH2
1 mg 62043 $83
Bac2A; Bactenecin 2A
RLARIVVIRVAR - NH2
RLARIVVIRVAR - NH2
1 mg 64906 $71
Biotin - LC - LL - 37
Biotin - LC - [LL-37, 37 aa]
Biotin - LC - LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRT
ES
0.5 mg 63693 $291
CAP - 18, rabbit
GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
0.5 mg 61307 $231
Cecropin A
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK - NH2
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK - NH2
0.5 mg 24009 $176
Cecropin A
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK - NH2
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK - NH2
1 mg 24010 $291
Cecropin B
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL - NH2
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL - NH2
0.5 mg 24011 $176
Cecropin B
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL - NH2
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL - NH2
1 mg 24012 $291
CSP - 2, Competence - Stimulating Peptide - 2
EMRISRIILDFLFLRKK
EMRISRIILDFLFLRKK
1 mg 63877 $105
Cys - LC - LL - 37
C - LC - [LL-37, 37 aa]
C - LC - [LL-37, 37 aa]
1 mg 63692 $291
Dermaseptin
ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ
ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ
0.5 mg 61913-05 $242
Dermcidin, DCD - 1L
SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLD
SVL
0.1 mg 63713 $143
Drosocin
GKPRPYSPRPTSHPRPIRV
GKPRPYSPRPTSHPRPIRV
1 mg 62600 $115
Elafin
AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16 - Cys45, Cys23 - Cys49, Cys32 - Cys44, Cys38 - Cys53)
AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCC
EGSCGMACFVPQ (Disufide bonds between Cys
16 - Cys45, Cys23 - Cys49, Cys32 - Cys44, Cys38 -
Cys53)
0.1 mg 61641 $237
HEL (46 - 61)
NTDGSTDYGILQINSR
NTDGSTDYGILQINSR
1 mg 60504-1 $143
Histatin - 5
DSHAKRHHGYKRKFHEKHHSHRGY
DSHAKRHHGYKRKFHEKHHSHRGY
1 mg 61001 $193
Histatin - 8 [Hemagglutination - Inhibiting Peptide (HIP)]
KFHEKHHSHRGY
KFHEKHHSHRGY
1 mg 61002 $99
Human Lactotransferrin (37 - 61), Lactoferricin H
TKCFQWQRNMRKVR - G - PPVSCIKRDS (Disulfide between Cys3 and Cys20)
TKCFQWQRNMRKVR - G - PPVSCIKRDS (Disulfide between Cys3 and Cys20)
1 mg 64074 $231
Human Platelet Factor IV 18, C18G
ALYKKLLKKLLKSAKKLG
ALYKKLLKKLLKSAKKLG
1 mg 62412 $110
Indolicidin
ILPWKWPWWPWRR - NH2
ILPWKWPWWPWRR - NH2
1 mg 60999 $143
Innate Defense Regulator - 1 (IDR - 1)
KSRIVPAIPVSLL
KSRIVPAIPVSLL
1 mg 62514 $83
KR - 12; LL - 37 (18 - 29)
KRIVQRIKDFLR
KRIVQRIKDFLR
1 mg 64812 $66
Lactoferricin B, Lactoferrin (17 - 41)
FKCRRWQWRMKKLGAPSITCVRRAF (S - S BOND)
FKCRRWQWRMKKLGAPSITCVRRAF (S - S BOND)
1 mg 62651 $198
LEAP - 1, Hepcidin, human
DTHFPICIFCCGCCHRSKCGMCCKT (Disulfide bridges: 7 - 23, 10 - 13, 11 - 19, 14 - 22)
DTHFPICIFCCGCCHRSKCGMCCKT (Disulfide bridges: 7 - 23, 10 - 13, 11 - 19, 14 - 22)
0.1 mg 61432 $215
LL - 37 fragment (18 - 37), LL - 18 - 37
KRIVQRIKDFLRNLVPRTES
KRIVQRIKDFLRNLVPRTES
1 mg 63712 $121
LL - 37 fragment (8 - 37), LL - 8 - 37
KSKEKIGKEFKRIVQRIKDFLRNLVPRTES
KSKEKIGKEFKRIVQRIKDFLRNLVPRTES
1 mg 63711 $242
LL - 37 pentamide
LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS
LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS
0.5 mg 61309 $231
LL - 37, acetylated & amidated
Ac - [LL-37, 37 aa] - NH2
Ac - [LL-37, 37 aa] - NH2
1 mg 63710 $303
LL - 37, Antimicrobial Peptide, human
[LL-37, 37 aa]
[LL-37, 37 aa]
1 mg 61302 $170
LL - 37, reverse sequence
SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
0.5 mg 62208 $143
LL - 37, scrambled
GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
1 mg 63708 $303
LL13 - 37  NEW
IGKEFKRIVQRIKDFLRNLVPRTES
IGKEFKRIVQRIKDFLRNLVPRTES
1 mg 65453-1 $90
LL13 - 37  NEW
IGKEFKRIVQRIKDFLRNLVPRTES
IGKEFKRIVQRIKDFLRNLVPRTES
5 mg 65453-5 $200
LL17 - 29  NEW
FKRIVQRIKDFLR
FKRIVQRIKDFLR
1 mg 65454-1 $70
LL17 - 29  NEW
FKRIVQRIKDFLR
FKRIVQRIKDFLR
5 mg 65454-5 $150
LL17 - 32  NEW
FKRIVQRIKDFLRNLV
FKRIVQRIKDFLRNLV
1 mg 65452-1 $70
LL17 - 32  NEW
FKRIVQRIKDFLRNLV
FKRIVQRIKDFLRNLV
5 mg 65452-5 $150
Magainin 1
GIGKFLHSAGKFGKAFVGEIMKS
GIGKFLHSAGKFGKAFVGEIMKS
0.5 mg 20791 $99
Magainin 1
GIGKFLHSAGKFGKAFVGEIMKS
GIGKFLHSAGKFGKAFVGEIMKS
1 mg 20792 $143
Magainin 2
GIGKFLHSAKKFGKAFVGEIMNS
GIGKFLHSAKKFGKAFVGEIMNS
0.5 mg 20639 $99
Magainin 2
GIGKFLHSAKKFGKAFVGEIMNS
GIGKFLHSAKKFGKAFVGEIMNS
1 mg 20640 $143
mCRAMP, mouse
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
1 mg 61305 $275
Melittin, honey bee
GIGAVLKVLTTGLPALISWIKRKRQQ - NH2
GIGAVLKVLTTGLPALISWIKRKRQQ - NH2
1 mg 62366 $181
NRC - 13 Pleurocidin
GWRTLLKKAEVKTVGKLALKHYL - NH2
GWRTLLKKAEVKTVGKLALKHYL - NH2
1 mg 64981 $171
OV - 1, sheep
KNLRRIIRKIIHIIKKYG
KNLRRIIRKIIHIIKKYG
1 mg 61310 $115
Protegrine - 1 (PG - 1), amide
RGGRLCYCRRRFCVCVGR - NH2 (disulfide bridge:6 - 15 and 8 - 13)
RGGRLCYCRRRFCVCVGR - NH2 (disulfide bridge:6 - 15 and 8 - 13)
1 mg 64819-1 $550
Protegrine - 1 (PG - 1), amide
RGGRLCYCRRRFCVCVGR - NH2 (disulfide bridge:6 - 15 and 8 - 13)
RGGRLCYCRRRFCVCVGR - NH2 (disulfide bridge:6 - 15 and 8 - 13)
0.5 mg 64819-05 $313
Pyrrhocoricin
VDKGSYLPRPTPPRPIYNRN
VDKGSYLPRPTPPRPIYNRN
1 mg 62601 $121
rCRAMP
GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ
GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ
0.5 mg 61306 $231
SMAP 29, Sheep Myeloid Antimicrobial Peptide 29
RGLRRLGRKIAHGVKKYGPTVLRIIRIAG
RGLRRLGRKIAHGVKKYGPTVLRIIRIAG
1 mg 61308 $231
Sub5
RRWKIVVIRWRR - NH2
RRWKIVVIRWRR - NH2
1 mg 64962 $66
Temporin A, amide
FLPLIGRVLSGIL - NH2
FLPLIGRVLSGIL - NH2
1 mg 64831 $83
Temporin L, amide
FVQWFSKFLGRIL - NH2
FVQWFSKFLGRIL - NH2
1 mg 64836 $83
Ubiquitin (1 - 34)
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE
1 mg 62587 $297
Ubiquitin (65 - 76), (Ub2)
STLHLVLRLRGG
STLHLVLRLRGG
1 mg 62586 $93
  < Back