|
|
|
Peptides > CART (Cocaine- and Amphetamine-Regulated Transcript) Peptides
|
|
|
|
|
|
Cocaine- and Amphetamine-Regulated Transcript (CART) peptides are derived from a proCART polypeptide that is 89 amino acids in length in human. CART peptides are expressed in the brain, especially in the hypothalamic nuclei, the anterior pituitary gut, adrenals and pancreas. They are inhibitors of food intake and are closely associated with leptin and neuropeptide Y, two important peptides in food intake regulation. CART peptides are also involved in fear and startle behavior and may act as mediators or modulators of the actions of psycho-stimulant drugs. CART (55-102), CART (55-76), CART (62-76) fragments do not affect insulin secretion, even though they are expressed in the pancreas.
Ref: Hunter, R. and M. Kuhar, Curr. Drug Targets CNS Neurol. Disord. 2, 201 (2003); Baranowska, B. et al. Neuro. Endocrinol. Lett. 24, 224 (2003); Jaworski, J. et al. J. Pharmacol. Exp. Ther. 307, 1038 (2003); Colombo, M. et al. Pancreas 27, 161 (2003); Kristensen, P. et al. Nature 393, 72 (1998); Thim, L. et al. Int. J. Biochem. Cell Biol. 30, 1281 (1998).
|
|
|
| Product |
Size |
Catalog # |
US$ |
|
CART (55 - 102), human
VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLL
KCL (Disulfide bridge: 74 - 94, 68 - 86, and 88 - 1
01) |
0.1 mg |
24154 |
$457 |
 |
 |
CART (55 - 102), rat
IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLL
KCL (Disulfide bridge: 74 - 94, 68 - 86, and 88 - 1
01) |
0.1 mg |
24156 |
$457 |
|
|
|
|
|
|
|
