Alzheimer's Disease
  Beta-Amyloid Peptide Fragments

 Product Size Catalog # US$
[Ac-Lys(Me)16, N-Me-Val18]-beta-Amyloid (16-20)-NH2, Human, mouse/rat
Ac-K(Me)-L-(N-Me-V)-FF-NH2
1 mg 61344 $132
Beta-Amyloid (1-10), Human
DAEFRHDSGY
1 mg 64478 $61
Beta-Amyloid (1-10)-GG-K(Biotin), Human
DAEFRHDSGYGG-K(Biotin)
1 mg 62134 $121
Beta-Amyloid (1-11), Human
DAEFRHDSGYE
1 mg 22819 $71
Beta-Amyloid (1-12), Human
DAEFRHDSGYEV
1 mg 62967 $83
Beta-Amyloid (1-12)-Cys, Human
DAEFRHDSGYEVC
1 mg 65155 $71
Beta-Amyloid (1-13), Human
DAEFRHDSGYEVH
1 mg 64480 $83
Beta-Amyloid (1-14), Human
DAEFRHDSGYEVHH
1 mg 64484 $88
Beta-Amyloid (1-15), Human
DAEFRHDSGYEVHHQ
1 mg 61798 $93
Beta-Amyloid (1-15)-Lys16(HiLyte™ Fluor 488), Human 0.5 mg 62002-05 $237
Beta-Amyloid (1-16), Human
DAEFRHDSGYEVHHQK
1 mg 24225 $83
Beta-Amyloid (1-16), Human
DAEFRHDSGYEVHHQK
5 mg 24226 $341
Beta-Amyloid (1-16)-Lys(Biotin-LC)-NH2, Human
DAEFRHDSGYEVHHQK-K(Biotin-LC)-NH2
1 mg 62136 $181
Beta-Amyloid (1-17), Human
DAEFRHDSGYEVHHQKL
1 mg 61955 $110
Beta-Amyloid (1-17), HiLyte™ Fluor 488-labeled, Human
HiLyte™ Fluor 488-DAEFRHDSGYEVHHQKL
0.1 mg 62953 $115
Beta-Amyloid (1-17)-Cys, Human
DAEFRHDSGYEVHHQKLC
1 mg 62473 $121
Beta-Amyloid (1-20), Human
DAEFRHDSGYEVHHQKLVFF
1 mg 62456 $121
Beta-Amyloid (1-22), Human
DAEFRHDSGYEVHHQKLVFFAE
1 mg 62966 $181
Beta-Amyloid (1-33), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
0.5 mg 60250-05 $253
Beta-Amyloid (1-33), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
1 mg 60250-1 $413
Beta-Amyloid (1-34), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
0.5 mg 61799 $176
Beta-Amyloid (1-36), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV
0.5 mg 60252-05 $264
Beta-Amyloid (1-36), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV
1 mg 60252-1 $423
Beta-Amyloid (1-37), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
0.5 mg 60251-05 $264
Beta-Amyloid (1-37), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
1 mg 60251-1 $423
Beta-Amyloid (1-38), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
0.5 mg 24233 $154
Beta-Amyloid (1-38), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
1 mg 24234 $275
Beta-Amyloid (1-39), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
0.5 mg 24295 $181
Beta-Amyloid (1-39), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
1 mg 24296 $335
Beta-Amyloid (1-41), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVI
1 mg 64559 $330
Beta-Amyloid (1-9), Human
DAEFRHDSG
1 mg 61970 $71
Beta-Amyloid (1-9)-Lys(Biotin-LC)-NH2, Human
DAEFRHDSG-K(Biotin-LC)-NH2
1 mg 61973 $105
Beta-Amyloid (10-20), Human
YEVHHQKLVFF
0.5 mg 25364 $39
Beta-Amyloid (10-20), Human
YEVHHQKLVFF
1 mg 25365 $61
Beta-Amyloid (10-26), Human
YEVHHQKLVFFAEDVGS
1 mg 62885 $105
Beta-Amyloid (10-35)-Lys(Biotin)-NH2, Human
YEVHHQKLVFFAEDVGSNKGAIIGLM-K(Biotin)-NH2
0.1 mg 63745 $121
Beta-Amyloid (11-17), Human
EVHHQKL
1 mg 63819 $71
Beta-Amyloid (11-22), Human
EVHHQKLVFFAE
1 mg 23956 $99
Beta-Amyloid (11-25), Human
EVHHQKLVFFAEDVG
1 mg 62884 $93
Beta-Amyloid (15-36), Human, mouse/rat
QKLVFFAEDVGSNKGAIIGLMV
1 mg 62023 $242
Beta-Amyloid (16-20), Human, mouse/rat
KLVFF
1 mg 60229-1 $61
Beta-Amyloid (16-20), Human, mouse/rat
KLVFF
5 mg 60229-5 $242
Beta-Amyloid (16-20), HiLyte™ Fluor 555-labeled, Human, mouse/rat
HiLyte™ Fluor 555-KLVFF
1 mg 63305 $291
Beta-Amyloid (16-22), Human, mouse/rat
KLVFFAE
1 mg 62897 $71
Beta-Amyloid (17-24), Human, mouse/rat
LVFFAEDV
1 mg 61978 $71
Beta-Amyloid (2-16), Human
AEFRHDSGYEVHHQK
1 mg 64794 $83
Beta-Amyloid (2-16)-Lys(Biotin-LC)-NH2, Human
AEFRHDSGYEVHHQK-K(Biotin-LC)-NH2
0.5 mg 64154 $99
Beta-Amyloid (22-35), Human, mouse/rat
EDVGSNKGAIIGLM
1 mg 22823 $115
Beta-Amyloid (22-35), Human, mouse/rat
EDVGSNKGAIIGLM
5 mg 22824 $462
Beta-Amyloid (25-35) • HCl, Human, mouse/rat
GSNKGAIIGLM • HCl
1 mg 21647 $77
Beta-Amyloid (25-35) • HCl, Human, mouse/rat
GSNKGAIIGLM • HCl
5 mg 23212 $313
Beta-Amyloid (25-35), Human, mouse/rat
GSNKGAIIGLM
1 mg 24227 $49
Beta-Amyloid (25-35), Human, mouse/rat
GSNKGAIIGLM
5 mg 24228 $193
Beta-Amyloid (25-35), HiLyte™ Fluor 488-labeled, Human, mouse/rat
HiLyte™ Fluor 488-GSNKGAIIGLM
0.1 mg 63308 $110
Beta-Amyloid (25-35), scrambled, Human, mouse/rat
MAKGINGISGL
1 mg 61971 $71
Beta-Amyloid (29-38), Human, mouse/rat
GAIIGLMVGG
1 mg 62923 $77
Beta-Amyloid (3-16), Human
EFRHDSGYEVHHQK
1 mg 64793 $77
Beta-Amyloid (3-16)-Lys(Biotin-LC)-NH2, Human
EFRHDSGYEVHHQK-K(Biotin-LC)-NH2
0.5 mg 64155 $93
Beta-Amyloid (35-25), Human, mouse/rat
MLGIIAGKNSG
1 mg 25367 $110
Beta-Amyloid (4-13), Human
FRHDSGYEVH
1 mg 62954 $77
Beta-Amyloid (4-16)-Lys(Biotin-LC)-NH2, Human
FRHDSGYEVHHQK-K(Biotin-LC)-NH2
0.5 mg 64156 $83
Beta-Amyloid (4-24), Human
FRHDSGYEVHHQKLVFFAEDV
1 mg 62961 $176
Beta-Amyloid (40-1), Human
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
0.5 mg 22817 $193
Beta-Amyloid (40-1), Human
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
1 mg 22818 $325
Beta-Amyloid (6-17), Human
HDSGYEVHHQKL
1 mg 64479 $77
Beta-Amyloid (6-30), Human
HDSGYEVHHQKLVFFAEDVGSNKGA
1 mg 62888 $203
Biotin-beta-Amyloid (17-24), Human, mouse/rat
BIOTIN-LVFFAEDV
1 mg 61980 $83
Biotin-beta-Amyloid (25-35), Human, mouse/rat
Biotin-GSNKGAIIGLM
1 mg 62451 $105
Biotin-LC-beta-Amyloid (15-25), Human, mouse/rat
Biotin-LC-QKLVFFAEDVG
1 mg 62907 $115
Biotin-LC-beta-Amyloid (22-41), Human, mouse/rat
Biotin-LC-EDVGSNKGAIIGLMVGGVVI
1 mg 62455 $198
ClearPoint™ beta-Amyloid (1-15), 13C, 15N-Arg, Human
DAEF-R*-HDSGYEVHHQ [R*=R(U-13C6, U-15N4)]
0.05 mg 64495 $105
ClearPoint™ beta-Amyloid (1-38), 13C-Phe & Ile, Human
DAEFRHDSGYEVHHQKLV-*F-*F-AEDVGSNKGA-*I-*I-GLMVGG *F=Phe(U-13C9), *I=Ile(U-13C6)
0.05 mg 65220 $117
Cys-beta-Amyloid (1-12), Human
CDAEFRHDSGYEV
1 mg 64353 $105
DABCYL-beta-Amyloid (11-22)-EDANS, Human
DABCYL-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-EDANS
1 mg 23551 $264
  < Back