Hormones
   Disulfide Cyclized Peptides

 Product Size Catalog # US$
α-Calcitonin Gene Related Peptide, α-CGRP, rat
SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (Disulfide bridge: 2-7)
1 mg 60730 $259
Adrenomedullin (1-52), human
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)
0.5 mg 60447 $335
Biotin-Calcitonin, human
Biotin-CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
0.5 mg 23580 $303
BNP (64-95), rat
NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: 10-26)
1 mg 22931 $385
BNP-32, human
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
0.5 mg 24015 $242
BNP-32, human
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
1 mg 24016 $385
Calcitonin Gene Related Peptide, CGRP, human
ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge: 2-7)
0.5 mg 20681 $154
Calcitonin Gene Related Peptide, CGRP, human
ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge: 2-7)
1 mg 20682 $259
Calcitonin, human
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
1 mg 20673 $137
Calcitonin, human
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
5 mg 20674 $577
Calcitonin, rat
CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 (Disulfide bridge: 1-7)
5 mg 24205 $577
Calcitonin, salmon
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
1 mg 20677 $121
Calcitonin, salmon
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
5 mg 20678 $484
Orexin A, bovine, human, mouse, rat
Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (Disulfide bridge: 6-12 and 7-14)
0.5 mg 24469 $423
Orexin A, bovine, human, mouse, rat
Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (Disulfide bridge: 6-12 and 7-14)
1 mg 24470 $480
Somatostatin 14
AGCKNFFWKTFTSC (Disulfide bridge: 3-14)
1 mg 24277 $55
Somatostatin 14
AGCKNFFWKTFTSC (Disulfide bridge: 3-14)
5 mg 24278 $220
Somatostatin 28
SANSNPAMAPRERKAGCKNFFWKTFTSC (Disulfide bridge: 17-28)
0.5 mg 22901 $110
Somatostatin 28
SANSNPAMAPRERKAGCKNFFWKTFTSC (Disulfide bridge: 17-28)
1 mg 22902 $154
  < Back