Hormones
  Prolactin Releasing Peptides

 Product Size Catalog # US$
Prolactin Releasing Peptide (1-31), human
SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2
0.5 mg 28215 $242
  < Back