Immunology
  OVA Peptides

 Product Size Catalog # US$
OVA (241-270)
SMLVLLPDEVSGLEQLESIINFEKLTEWTS
1 mg AS-64525 $209
OVA (257-264)
SIINFEKL
1 mg AS-60193-1 $49
OVA (257-264)
SIINFEKL
5 mg AS-60193-5 $198
OVA (257-264), FAM labeled
5-FAM-SIINFEKL-NH2
1 mg AS-64231 $225
OVA (257-264), scrambled, FILKSINE
FILKSINE
1 mg AS-64413 $99
OVA (323-339)
ISQAVHAAHAEINEAGR
1 mg AS-27024 $110
OVA (323-339)
ISQAVHAAHAEINEAGR
5 mg AS-27025 $435
OVA (323-339), biotin-labeled
Biotin-ISQAVHAAHAEINEAGR
1 mg AS-64767 $165
OVA (323-339), FITC-labeled
FITC-LC-ISQAVHAAHAEINEAGR
1 mg AS-64766 $247
OVA (329-337)
AAHAEINEA
1 mg AS-64777 $77
OVA (55-62), KVVRFDKL
KVVRFDKL
1 mg AS-64412 $99
OVA-A2 Peptide, SAINFEKL, OVA (257-264) Variant
SAINFEKL
1 mg AS-64383 $99
OVA-G4 Peptide, SIIGFEKL, OVA (257-264) Variant
SIIGFEKL
1 mg AS-64384 $99
OVA-Q4 Peptide, pQ4, SIIQFEKL, OVA (257-264) Variant  
SIIQFEKL
1 mg AS-64402 $99
OVA-Q4H7 Peptide, pQ4H7, SIIQFEHL, OVA (257-264) Variant  
SIIQFEHL
1 mg AS-64405 $99
OVA-T4 Peptide, SIITFEKL, pT4, OVA (257-264) Variant  
SIITFEKL
1 mg AS-64403 $99
  < Back