Neurobiology
  Cell Permeable Peptides (CPP) / Drug Delivery Peptides

 Product Size Catalog # US$
Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)
YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
1 mg 62565 $484
Rabies Virus Glycoprotein (RVG)
YTIWMPENPRPGTPCDIFTNSRGKRASNG
1 mg 62566 $225
TAT-GluR23A Fusion Peptide
YGRKKRRQRRRAKEGANVAG
1 mg 64984 $110
Tat-NR2Bct
YGRKKRRQRRRKLSSIESDV
1 mg 62042 $237
  < Back