Neurobiology
  Neuropeptides

 Product Size Catalog # US$
LCMV NP396 H-2Db peptide
FQPQNGQFI
1 mg 61700 $71
MOG (101-120), human, mouse
RDHSYQEEAAMELKVEDPFY
1 mg 62370 $121
Neuropeptide S, NPS (1-10), rat
SFRNGVGSGV
1 mg 62599 $71
Neurotensin
QLYENKPRRPYIL
1 mg 62677 $83
NPVF
VPNLPQRF-NH2
1 mg 62006 $71
QF-ERP7, FRET
Abz-GGFLRRV-EDDnp
0.5 mg 62728 $143
Secretoneurin
TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
1 mg 62673 $286
VGF Protein Precursor (491-507)
PPEPVPPPRAAPAPTHV
1 mg 62703 $105
WE-14
WSRMDQLAKELTAE
1 mg 62672 $93
  < Back