Bone Related Disease
  Osteocalcin Fragments

 Product Size Catalog # US$
Des-gamma-carboxylated Osteocalcin/Bone Gla Protein
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
0.25 mg 65307-025 $175
  < Back