Peptides

Adropin (34-76), 0.1mg

$215.00
Check your price
  • Cat.Number : AS-65654
  • Availability :
    In production

Quantity

Adropin is a secreted hormone that regulates lipid and glucose metabolism. It is mainly expressed in brain and liver and is encoded by the energy homeostasis associated gene. It has been shown that adropin has beneficial effect in obesity animal models.

Specifications

Chemistry
Sequence one letter code
  • CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP-OH
Sequence three letter code
  • Cys-His-Ser-Arg-Ser-Ala-Asp-Val-Asp-Ser-Leu-Ser-Glu-Ser-Ser-Pro-Asn-Ser-Ser-Pro-Gly-Pro-Cys-Pro-Glu-Lys-Ala-Pro-Pro-Pro-Gln-Lys-Pro-Ser-His-Glu-Gly-Ser-Tyr-Leu-Leu-Gln-Pro-OH
Molecular Formula
  • C190H295N55O68S2
Molecular Mass/ Weight
  • 4501.88
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • Human/Mouse/Rat