Peptides

Ryanodine receptor 1 (RyR1) (3614-3643); Calmodulin Binding Peptide (CaMBP) - 1 mg

$262.00
Check your price
  • Cat.Number : AS-64606
  • Availability :
    In stock

Quantity

This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium.

Specifications

Chemistry
Sequence one letter code
  • KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
Sequence three letter code
  • H-Lys-Ser-Lys-Lys-Ala-Val-Trp-His-Lys-Leu-Leu-Ser-Lys-Gln-Arg-Arg-Arg-Ala-Val-Val-Ala-Cys-Phe-Arg-Met-Thr-Pro-Leu-Tyr-Asn-OH
Molecular Formula
  • C163H272N52O37S2
Molecular Mass/ Weight
  • 3616.6
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human, mouse, rat, bovine, pig

You may also be interested in the following product(s)

IMG-EN-AS-62604-01.jpg

Caloxin 2A1 - 1 mg

Cat.Number : AS-62604
$137.00 Excl. Tax
IMG-EN-AS-60763-01.jpg

Iberiotoxin (IbTX) - 0.1 mg

Cat.Number : AS-60763
$198.00 Excl. Tax
IMG-EN-AS-22926-01.jpg

ω-Conotoxin GVIA

Cat.Number : AS-22926
$287.00 Excl. Tax

References

Dissociation of Calmodulin-Target Peptide Complexes by the Lipid Mediator Sphingosylphosphorylcholine IMPLICATIONS IN CALCIUM SIGNALING

J Biol Chem . 2010 Jan 01 ; 285(3) 1799 | DOI : https://doi.org/10.1074/jbc.M109.053116

  • E. Kovacs
  • et al