IMG-EN-AS-72215-01.jpg
Peptides

AggreSure ß-Amyloid (1-40), human - 0.25 mg

$330.00
Check your price
  • Cat.Number : AS-72215
  • Availability :
    In stock
  • Shipping conditions : Ice fees will apply

Alternative choices

Quantity

Add to wishlist Bulk Quote

AggreSure beta-Amyloid (1-40) peptide is pretreated and tested for aggregation using SensoLyte® ThT Aβ40 Aggregation kit (Cat# AS-72213). Aggregation is guaranteed. The quantity is 0.25mg net peptide.

Alzheimer's Disease (AD) is the most common neurodegenerative disorder in elderly people. It has been demonstrated that AD has biological causes and is characterized by the presence of senile plaques and neurofibrillary tangles mainly in cerebral cortex and hippocampus brain regions. Beta-Amyloid (1-40) (Aβ40) and beta-Amyloid (1-42) (Aβ42) are the main components of the above plaques; however, other forms of beta-Amyloid peptides are also present. Both peptides are cleaved from the Amyloid Precursor Protein (APP) by β-secretase and ?-secretase enzymes. Many studies suggest that Aβ42 or/and Aβ43 are required to initiate formation of amyloid plaques and neurofibrills that leads to the neurodegeneration, while Aβ40 is less neurotoxic.

Specifications

Chemistry
Sequence one letter code
  • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
CAS registry number
  • 131438-79-4
UniProt number
  • P05067
Molecular Formula
  • C194H295N53O58S
Molecular Mass/ Weight
  • 4330.2
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Resuspension condition
  • Reconstitute peptide in either 50mM Tris/150mM NaCl (pH 7.2) or 20mM HEPES/150mM NaCl (pH 7.2) at 0.25 mg/ml. Use water bath sonicator to completely dissolve peptide if necessary. Do not vortex!
Storage Conditions
  • Store at -20°C. Do not freeze-thaw reconstituted peptide.
Activity
Application
Biomarker Target
Detection Method
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

Downloads

You may also be interested in the following product(s)

IMG-EN-AS-24235-01.jpg

Beta-Amyloid (1-40) Peptide

Cat.Number : AS-24235-
$161.00 Excl. Tax
IMG-EN-AS-55553-01.jpg

SensoLyte® Anti-Mouse/Rat ß-Amyloid (1-40) Quantitative ELISA Kit Colorimetric - 1 kit

Cat.Number : AS-55553
$594.00 Excl. Tax
IMG-EN-AS-72213-01.jpg

SensoLyte® Thioflavin T ß-Amyloid (1-40) Aggregation Kit - 1 kit

Cat.Number : AS-72213
$621.00 Excl. Tax

Citations

Physiological loading of joints prevents cartilage degradation through CITED2

FASEB J . 2010 Sep 08 ; 25 182 | DOI : 10.1096/fj.10-164277

  • D. Leong

Interstitial flow promotes vascular fibroblast, myofibroblast, and smooth muscle cell motility in 3-D collagen I via upregulation of MMP-1

Am J Physiol Heart Circ Physiol . 2009 May 22 ; 297 H1225 | DOI : 10.1152/ajpheart.00369.2009

  • Z-D. Shi

Synthesis of dammarane-type triterpene derivatives and their ability to inhibit HIV and HCV proteases

Bioorg Med Chem . 2009 Mar 14 ; 17(8) 3003 | DOI : 10.1016/j.bmc.2009.03.019

  • Y. Wei

Enantiomeric Aβ peptides inhibit the fluid shear stress response of PIEZO1

Nature . 2018 Sep 24 ; 8 14267 | DOI : 10.1038/s41598-018-32572-2

  • MM. Maneshi

Aβ40 Reduces P-Glycoprotein at the Blood-Brain Barrier through the Ubiquitin-Proteasome Pathway.

J Neurosci. . 2016 Feb 01 ; 36(6) 1930 | DOI : 10.1523/JNEUROSCI.0350-15.2016

  • AM. Hartz

Effects of Melatonin and Beta-Amyloid on Mitochondrial Function in a Model of Aging Mouse Astrocytes. 

FASEB J . 2016 Apr 18 ; 702,1

  • EK. Debner
  • JM. King

Humanin Blocks the Aggregation of Amyloid-β Induced by Acetylcholinesterase, an Effect Abolished in the Presence of IGFBP-3

Biochemistry . 2020 Jun 02 ; 59(21) 1981 | DOI : 10.1021/acs.biochem.0c00274

  • D. Price
  • et al

Interaction of amyloid beta with humanin and acetylcholinesterase is modulated by ATP

FEBS . 2020 Nov 03 ; 10(12) 2805 | DOI : https://doi.org/10.1002/2211-5463.13023

  • S. Atali
  • et al