Peptides

Beta-Amyloid (1-40) Peptide

$161.00
Check your price
  • Cat.Number : AS-24235-
  • Availability :
    In stock

Select specification

Size

Quantity

Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain.
Electron microscopy of b-amyloid (1-40) stained with Thioflavin T (data generated by an AnaSpec scientist).

Specifications

Chemistry
Sequence one letter code
  • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
CAS registry number
  • 131438-79-4
Molecular Formula
  • C194H295N53O58S
Molecular Mass/ Weight
  • 4329.9
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

IMG-EN-AS-61322-01.jpg

1 % NH4OH solution - 300 µl

Cat.Number : AS-61322
$26.00 Excl. Tax
IMG-EN-AS-20276-01.jpg

Beta-Amyloid (1-42)

Cat.Number : AS-20276
$341.00 Excl. Tax

Citations

Combined Treatment with a BACE Inhibitor and Anti-Aβ Antibody Gantenerumab Enhances Amyloid Reduction in APPLondon Mice

J Neurosci . 2014 Aug 27 ; 34(35) 11621 | DOI : 10.1523/JNEUROSCI.1405-14.2014

  • H. Jacobsen

Microglial Amyloid-1-40 Phagocytosis Dysfunction Is Caused by High-Mobility Group Box Protein-1: Implications for the Pathological Progression of Alzheimer’s Disease

Int J Alzheimers Dis . 2012 Feb 24 ; 2012 11 | DOI : http://dx.doi.org/10.1155/2012/685739

  • K. Takata

A screening UHPLC–MS/MS method for the analysis of amyloid peptides in cerebrospinal fluid of preclinical species

Bioanalysis . 2010 Dec 23 ; 3(1) 45 | DOI : 10.4155/bio.10.163

Regulation of Matrix Metalloproteinase 2 by Oligomeric Amyloid β Protein

Brain Res . 2011 Mar 02 ; 1387 141 | DOI : 10.1016/j.brainres.2011.02.078

  • W. Li

Structural and functional alterations in amyloid-β precursor protein induced by amyloid-β peptides

J Alzheimers Dis . 2014 Apr 28 ; 25(3) 547 | DOI : 10.3233/JAD-2011-101938

  • CP. Libeu

CpG-ODNs induces up-regulated expression of chemokine CCL9 in mouse macrophages and microglia

Cellular Immuno . 2010 Jan 01 ; 260(2) 113 | DOI : https://doi.org/10.1016/j.cellimm.2009.10.001

  • C. Ravindran

Gelsolin Restores A-Induced Alterations in Choroid Plexus Epithelium

J Biomed and Biotech . 2010 Jan 19 ; 2010 7 | DOI : http://dx.doi.org/10.1155/2010/805405

  • T. Vargas

Mutant presenilin 1 increases the expression and activity of BACE1

JBC . 2009 Feb 05 ; 284 9027 | DOI : 10.1074/jbc.M805685200

  • L. Giliberto

Spatial Memory Impairment Without Apoptosis Induced by the Combination of Beta-Amyloid Oligomers and Cerebral Ischemia Is Related to Decreased Acetylcholine Release in Rats

J Pharmacol Sci . 2007 Nov 13 ; 106 84 | DOI : 10.1254/jphs.fp0071648

  • T. Watanabe

Aβ and tau form soluble complexes that may promote self aggregation of both into the insoluble forms observed in Alzheimer's disease

PNAS . 2006 Feb 07 ; 103(6) 1953 | DOI : https://doi.org/10.1073/pnas.0509386103

  • J-P. Guo

CLAC Binds to Amyloid β Peptides through the Positively Charged Amino Acid Cluster within the Collagenous Domain 1 and Inhibits Formation of Amyloid Fibrils

JBC . 2004 Dec 21 ; 280 15484 | DOI : 10.1074/jbc.M413340200

  • Y. Osada

Effects of hydroxyl group variations on a flavonoid backbone toward modulation of metal-free and metal-induced amyloid-β aggregation

Inorg. Chem. Front. . 2016 Jan 13 ; 3 381 | DOI : 10.1039/C5QI00219B

  • HJ. Lee

Cilostazol suppresses β‐amyloid production by activating a disintegrin and metalloproteinase 10 via the upregulation of SIRT1‐coupled retinoic acid receptor‐β

J Neurosci Res. . 2014 Jun 05 ; 92(11) 1581 | DOI : 10.1002/jnr.23421

  • HR. Lee

Insights into antiamyloidogenic properties of the green tea extract (-)-epigallocatechin-3-gallate toward metal-associated amyloid-β species.

Proc Natl Acad Sci U S A . 2013 Feb 20 ; 110(10) 3743 | DOI : 10.1073/pnas.1220326110

  • SJ. Hyung

Bapineuzumab captures the N-terminus of the Alzheimer's disease amyloid-beta peptide in a helical conformation

Scientific Rpt . 2013 Feb 18 ; 3 | DOI : 10.1038/srep01302

  • LA. Miles

Effects of NK-4 in a Transgenic Mouse Model of Alzheimer's Disease

PLoS One. . 2012 Jan 04 ; 7(1) e30007 | DOI : https://doi.org/10.1371/journal.pone.0030007

  • H. Ohta

Quantitation of amyloid beta peptides in CSF by surface enhanced MALDI-TOF

Methods Mol Biol . 2011 Oct 12 ; 818 227 | DOI : 10.1007/978-1-61779-418-6_16

  • E. Takahashi

Microglial Amyloid-β1-40 Phagocytosis Dysfunction is Caused by High-Mobility Group Box Protein-1: Implications for the Pathological Progression of Alzheimer’s Disease

Int J Alz Dis . 2012 May 08 ; 2012 685739 | DOI : https://doi.org/10.1155/2012/685739

  • K. Takata

Somatostatin modulates insulin-degrading-enzyme metabolism: Implications for the regulation of microglia activity in AD

PLoS One. . 2012 Apr 03 ; 7(4) e34376 | DOI : 10.1371/journal.pone.0034376

  • G. Tundo

Synthesis and characterization of IMPY derivatives that regulate metal-induced amyloid-β aggregation

Metallomics. . 2011 Jan 06 ; 3(3) 284 | DOI : 10.1039/c0mt00077a

  • JS. Choi

Inhibition of amyloid-β aggregation by coumarin analogs can be manipulated by functionalization of the aromatic center

Bioorg Med Chem. . 2011 Mar 12 ; 19(8) 2596 | DOI : 10.1016/j.bmc.2011.03.010

  • D. Soto-Ortega

A partially folded structure of amyloid-beta(1-40) in an aqueous environment.

Biochem Biophys Res Commun . 2011 Jun 25 ; 411(2) 312 | DOI : 10.1016/j.bbrc.2011.06.133

  • S. Vivekanandan

Neuroprotective effect of honokiol and magnolol, compounds from Magnolia officinalis, on beta-amyloid-induced toxicity in PC12 cells

Phytother Res. . 2010 Jun 01 ; 24(10) 1538 | DOI : 10.1002/ptr.3178

  • C. Hoi

Gelsolin Restores Aβ-Induced Alterations in Choroid Plexus Epithelium

J Biomed Biotechnol . 2010 Mar 25 ; 2010 805405 | DOI : https://doi.org/10.1155/2010/805405

  • T. Vargas

Comparative study of inhibition at multiple stages of amyloid-β self-assembly provides mechanisitic insight

Mol Pharmacol. . 2009 May 29 ; 76(2) 405 | DOI : 10.1124/mol.109.055301

  • TJ. Davis

Dynamic fluorescence imaging analysis to investigate the cholesterol recruitment in lipid monolayer during the interaction between beta-amyloid (1-40) and lipid monolayers.

Colloids Surf B Biointerfaces. . 2009 Jun 23 ; 74(1) 59 | DOI : 10.1016/j.colsurfb.2009.06.027

  • MS. Lin

Differential modification of Cys10 alters transthyretin's effect on beta-amyloid aggregation and toxicity

Protein Eng Des Sel . 2009 Jun 23 ; 22(8) 479 | DOI : 10.1093/protein/gzp025

  • L. Liu

The cleavage products of amyloid-β precursor protein are sorted to distinct carrier vesicles that are independently transported within neurites

J Neurosci.  . 2009 Mar 18 ; 29(11) 3565 | DOI : 10.1523/JNEUROSCI.2558-08.2009

  • V. Muresan

Simvastatin protects against amyloid β and HIV-1 tat-induced promoter activities of inflammatory genes in brain endothelial cells

Mol Pharmacol . 2008 Feb 14 ; 73(5) 1424 | DOI : 10.1124/mol.107.042028

  • IE. Andras

Bio-assay guided isolation and identification of anti-Alzheimer active compounds from the root of Angelica sinensis

Food Chem . 2008 Sep 23 ; 114(1) 246 | DOI : https://doi.org/10.1016/j.foodchem.2008.09.046

  • CC. Ho

Identifying the minimal copper- and zinc-binding site sequence in amyloid-β peptides

J Biol Chem . 2008 Jan 30 ; 283(16) 10784 | DOI : 10.1074/jbc.M707109200

  • V. Minicozzi

Enzymatic characteristics of I213T mutant presenilin-1/gamma-secretase in cell models and knock-in mouse brains: familial Alzheimer disease-linked mutation impairs gamma-site cleavage of amyloid precursor protein C-terminal fragment beta.

J Biol Chem . 2008 Apr 21 ; 283(24) 16488 | DOI : 10.1074/jbc.M801279200

  • M. Shimojo

Activation of 5-HT4 receptors inhibits secretion of β peptides and increase neuronal survival

Exp Neurol. . 2016 Sep 15 ; 203(1) 274 | DOI : 10.1016/j.expneurol.2006.07.021

  • S. Cho

Soluble aggregates of the amyloid-β protein activate endothelial monolayers for adhesion and subsequent transmigration of monocyte cells

J Neurochem . 2007 Oct 22 ; 104(2) 500 | DOI : 10.1111/j.1471-4159.2007.04988.x

  • FJ. Gonzales-Velasquez

Role of aggregation conditions in structure, stability, and toxicity of intermediates in the Aβ fibril formation pathway

Protein Sci . 2007 Apr 01 ; 16(4) 723 | DOI : 10.1110/ps.062514807

  • S. Lee

Early-onset behavioral and synaptic deficits in a mouse model of Alzheimer's disease

PNAS . 2006 Mar 28 ; 103(13) 5161 | DOI : https://doi.org/10.1073/pnas.0600948103

  • JS. Jacobsen

Protofibril Formation of Amyloid β-Protein at Low pH via a Non-cooperative Elongation Mechanism

J Biol Chem . 2005 May 28 ; 280(34) 30001 | DOI : 10.1074/jbc.M500052200

  • R. Carrotta

Elucidating the Kinetics of β-Amyloid Fibril Formation

ACS Symposium Series . 2005 Sep 29 ; 916(13) | DOI : 10.1021/bk-2005-0916.ch009

  • NJ. Edwin

Specific binding of amyloid-β-protein to IMR-32 neuroblastoma cell membrane

J Pept Res . 2008 Dec 05 ; 65(5) 485 | DOI : https://doi.org/10.1111/j.1399-3011.2005.00250.x

  • S. Inaba

Cholesterol depletion inhibits the degradation of amyloid beta-peptide in rat pheochromocytoma (PC12) cells.

Neurosci Lett. . 2005 Sep 09 ; 391(1-2) 71 | DOI : 10.1016/j.neulet.2005.08.034

  • XZ. Sun

Transglutaminase catalyzes differential crosslinking of small heat shock proteins and amyloid-β

FEBS Lett . 2004 Oct 08 ; 576(1-2) 57 | DOI : 10.1016/j.febslet.2004.08.062

  • S. Boros

Rapid method for measurement of surface tension in multiwell plates

Lab Invest. . 2004 Jan 19 ; 84(4) 523 | DOI : 10.1038/labinvest.3700054

  • MG. Cottingham

Insertion of Alzheimer's Aβ40 Peptide into Lipid Monolayers

Biophys J. . 2004 Sep 01 ; 87(3) 1732 | DOI : 10.1529/biophysj.104.043265

  • C. Ege

Glypican-1 as an Aβ binding HSPG in the human brain: Its localization in DIG domains and possible roles in the pathogenesis of Alzheimer’s disease

FASEB J . 2004 Apr 14 ; 18(9) | DOI : https://doi.org/10.1096/fj.03-1040fje

  • N. Watanabe

Targeted control of kinetics of β-amyloid self-association by surface tension-modifying peptides

J Biol Chem. . 2003 Aug 13 ; 278(42) 40730 | DOI : 10.1074/jbc.M305466200

  • JR. Kim

Humanin peptides block calcium influx of rat hippocampal neurons by altering fibrogenesis of Aβ(1–40).

Peptides . 2003 Jul 09 ; 24(5) 679 | DOI : 10.1016/s0196-9781(03)00131-1

  • P. Zou

Cholesterol Is an Important Factor Affecting the Membrane Insertion of β-Amyloid Peptide (Aβ1–40), Which May Potentially Inhibit the Fibril Formation

JBC . 2001 Dec 10 ; 277(8) 6273 | DOI : 10.1074/jbc.M104146200

  • SR. Ji

A novel compound RS-0466 reverse β-amyloid-induced cytotoxcity through the Akt signaling pathway in vitro

Eur J Pharmacol. . 2012 Dec 13 ; 457(1) 11 | DOI : 10.1016/s0014-2999(02)02657-2

  • Y. Nakagami

β-amyloid peptide-induced apoptosis regulated by a novel protein containing a G protein activation module

J Biol Chem. . 2001 Feb 20 ; 276(22) 18748 | DOI : 10.1074/jbc.M011161200

  • EM. Kajkowski

Inflammatory cytokine levels are influenced by interactions between THP-1 monocytic, U-373 MG astrocytic, and SH-SY5Y neuronal cell lines of human origin

Neurosci Lett. . 2001 Nov 02 ; 313(1-2) 41 | DOI : 10.1016/s0304-3940(01)02251-0

  • A. Klegeris

Structure−function relationships for inhibitors of β-amyloid toxicity containing the recognition sequence KLVFF

Biochemistry.  . 2001 Jul 03 ; 40(26) 7882 | DOI : 10.1021/bi002734u

  • TL. Lowe

A mathematical model of the kinetics of β-amyloid fibril growth from the denatured state

Biophys J . 2001 Sep 01 ; 81(3) 1805 | DOI : 10.1016/S0006-3495(01)75831-6

  • MM. Pallitto
  • RM. Murphy

Interaction between β-amyloid and lens αB-crystallin

FEBS Lett . 2000 Nov 03 ; 484(2) 98 | DOI : https://doi.org/10.1016/S0014-5793(00)02136-0

  • JJN. Liang

Expression of prostaglandin E synthase mRNA is induced in beta-amyloid treated rat astrocytes

Neurosci Lett . 2000 Apr 14 ; 283(3) 221 | DOI : 10.1016/s0304-3940(00)00926-5

  • K. Satoh

The Molecular Chaperone αB-crystallin Enhances Amyloid β Neurotoxicity

Res Communi . 2002 May 25 ; 262(1) 152 | DOI : https://doi.org/10.1006/bbrc.1999.1167

  • GJJ. Stege

Complement-dependent proinflammatory properties of the Alzheimer's disease β-peptide

JEM . 1998 Aug 03 ; 188(3) 431 | DOI : https://doi.org/10.1084/jem.188.3.431

  • BM. Bradt

Effect on memory of acute administration of naturally secreted fibrils and synthetic amyloid-beta peptides in an invertebrate model.

Neurobiol Learn Mem . 2007 Oct 24 ; 89(4) 407 | DOI : 10.1016/j.nlm.2007.08.011

  • M. Feld

Identifying the minimal Cu and Zn binding site sequence in amyloid beta peptides.

J Biol Chem . 2008 Jan 30 ; 283(16) 10784 | DOI : 10.1074/jbc.M707109200.

  • V. Minicozzi

Microchip electrophoresis profiling of Aβ peptides in the cerebrospinal fluid of patients with Alzheimer’s disease.

Anal Chem . 2010 Sep 15 ; 82(18) 7611 | DOI : 10.1021/ac101337n

  • M. Reza

Beta-amyloid peptide blocks the fast-inactivating K+ current in rat hippocampal neurons.

Biophys J 70, 296. . 1996 Jan 01 ; 70(1) 296 | DOI : 10.1016/S0006-3495(96)79570-X

  • TA. Good

Cholesterol depletion inhibits the degradation of amyloid β-peptide in rat pheochromocytoma (PC12) cells.

Neurosci. Lett. . 2005 Sep 09 ; 391(1-2) 71 | DOI : 10.1016/j.neulet.2005.08.034.

  • ZX. Sun

A novel compound RS-0466 reverses β-amyloid-induced cytotoxicity through the Akt signaling pathway in vitro.

Eur J Pharmacol . 2002 Dec 13 ; 457(1) 11 | DOI : 10.1016/s0014-2999(02)02657-2

  • Y. Nakagami

N-truncation and pyroglutaminylation enhances the opsonizing capacity of Aβ-peptides and facilitates phagocytosis by macrophages and microglia.

Brain Behav Immun . 2014 May 27 ; 41 116 | DOI : 10.1016/j.bbi.2014.05.003.

  • M. Condic

Quantification of Amyloid-β in Plasma by Simple and Highly Sensitive Immunoaffinity Enrichment and LC-MS/MS Assay

J Applied Lab Med . 2021 Jul 01 ; 6(4) 834 | DOI : https://doi-org.lib-proxy.fullerton.edu/10.1093/jalm/jfaa225

  • T. Iino
  • et al

References

Aging renders the brain vulnerable to amyloid beta-protein neurotoxicity

Nat Med . 1998 Jul 15 ; 4(7) 827 | DOI : https://doi.org/10.1038/nm0798-827

  • C. Geula
  • et al

Amyloid plaque core protein in Alzheimer disease and Down syndrome

Proc Nat Acad Sci USA . 1985 Jun 01 ; 82(12) 4245 | DOI : https://doi.org/10.1073/pnas.82.12.4245

  • CL. Masters
  • et al

Amyloid β-Protein (Aβ) 1–40 But Not Aβ1–42 Contributes to the Experimental Formation of Alzheimer Disease Amyloid Fibrils in Rat Brain

J Neurosci . 1997 Nov 01 ; 17(21) 8187 | DOI : https://doi.org/10.1523/JNEUROSCI.17-21-08187.1997

  • R. Shin
  • et al

Mechanisms of Neuronal Degeneration Review in Alzheimer’s Disease

Neuron . 1996 Jan 01 ; 16 921 | DOI : 10.1016/s0896-6273(00)80115-4

  • BA. Yankner