Peptides

Beta-Amyloid (1-40)-Cys - 0.1 mg

$121.00
Check your price
  • Cat.Number : AS-62233
  • Availability :
    In stock

Select specification

Quantity

This synthetic peptide corresponds to ß-Amyloid (1-40) with an additional cysteine at the C-terminus. This Cys-containing mutant can be used as a model for aggregation studies.

Specifications

Chemistry
Sequence one letter code
  • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVC
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Cys-OH
Molecular Formula
  • C197H300N54O59S2
Molecular Mass/ Weight
  • 4433.3
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)