Peptides

Beta-Amyloid (1-40), FAM-labeled

$146.00
Check your price
  • Cat.Number : AS-23514-01
  • Availability :
    In stock

Select specification

Size

Quantity

Beta-Amyloid (1-40) together with beta-Amyloid (1-42) are two major C-terminal variants of the beta-Amyloid protein. These beta-Amyloid peptides undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This is a fluorescent (FAM)-labeled ß-Amyloid (1-40), Abs/Em=494/521 nm. FAM is preferred over FITC because of its photo- and chemical stability.

494/521

Specifications

Chemistry
Sequence one letter code
  • FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence three letter code
  • FAM-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
CAS registry number
  • 1678416-08-4
Molecular Formula
  • C215H305N53O64S
Molecular Mass/ Weight
  • 4688.5
Properties
Absorbance (nm)
  • 494
Emission (nm)
  • 521
Modification
Conjugation type
  • Fluorescent dyes
Modification Name
Conjugation
  • Conjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C Protected from light
Activity
Biomarker Target
Detection Method
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

IMG-EN-AS-72215-01.jpg

AggreSure ß-Amyloid (1-40), human - 0.25 mg

Cat.Number : AS-72215
$285.00 Excl. Tax
IMG-EN-AS-20276-01.jpg

Beta-Amyloid (1-42)

Cat.Number : AS-20276
$310.00 Excl. Tax

Citations

Reversibility of β-amyloid self-assembly: Effects of pH and added salts assessed by fluorescence photobleaching recovery.

Biomacromolecules . 2010 Feb 08 ; 11(2) 341 | DOI : 10.1021/bm900833b.

  • NJ. Edwin

Lead-induced accumulation of β-amyloid in the choroid plexus: Role of low density lipoprotein receptor protein-1 and protein kinase C.

Neurotoxicology . 2010 May 19 ; 31(5) 524 | DOI : 10.1016/j.neuro.2010.05.004.

  • M. Behl

Enlargement of Aβ aggregates through chemokine-dependent microglial clustering.

Neurosci. Res. . 2009 Apr 01 ; 63(4) 280 | DOI : https://doi.org/10.1016/j.neures.2009.01.001

  • WC. Huang

Formation of Amyloids by Aβ-(1–42) on NGF-differentiated PC12 Cells: Roles of Gangliosides and Cholesterol.

J. Mol. Biol. . 2007 Jun 09 ; 371(4) 924 | DOI : 10.1016/j.jmb.2007.06.008

  • M. Wakabayashi

References

Selective binding of soluble Abeta1-40 and Abeta1-42 to a subset of senile plaques.

Am. J. Pathol. . 1996 Jun 01 ; 148(6) 1749 | DOI : PMC1861649

  • R. Prior
  • et al