Peptides

Beta-Amyloid (1-40) • HFIP

$179.00
Check your price
  • Cat.Number : AS-64128-05
  • Availability :
    In stock

Select specification

Size

Quantity

Removal of any preexisting structures in lyophilized stocks of Aβ-peptide is the critical initial step for controlled aggregation studies. HFIP has been shown to break down β-sheet structure, disrupting hydrophobic forces in aggregated amyloid preparations, and promoting α-helical secondary structure. HFIP treatment of lyophilized Aβ-peptide results in a dense, homogeneous preparation of unaggregated peptide and samples can be stored as peptide films.

Specifications

Chemistry
Sequence one letter code
  • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
CAS registry number
  • 131438-79-4
Molecular Formula
  • C194H295N53O58S
Molecular Mass/ Weight
  • 4330.2
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Application
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)