Peptides

Beta-Amyloid (40-1)

$213.00
Check your price
  • Cat.Number : AS-22817
  • Availability :
    In production

Size

Quantity

This peptide corresponds to the CtoN inverted sequence of Beta-amyloid 1-40

Specifications

Chemistry
Sequence one letter code
  • VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Sequence three letter code
  • H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH
CAS registry number
  • 144409-99-4
Molecular Formula
  • C194H295N53O58S
Molecular Mass/ Weight
  • 4330.2
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

IMG-EN-AS-72215-01.jpg

AggreSure ß-Amyloid (1-40), human - 0.25 mg

Cat.Number : AS-72215
$285.00 Excl. Tax
IMG-EN-AS-20276-01.jpg

Beta-Amyloid (1-42)

Cat.Number : AS-20276
$310.00 Excl. Tax

Citations

Simvastatin protects against amyloid β and HIV-1 tat-induced promoter activities of inflammatory genes in brain endothelial cells

Mol Pharmacol . 2008 Feb 14 ; 73(5) 1424 | DOI : 10.1124/mol.107.042028

  • IE. Andras

β-amyloid peptide-induced apoptosis regulated by a novel protein containing a G protein activation module

J Biol Chem. . 2001 Feb 20 ; 276(22) 18748 | DOI : 10.1074/jbc.M011161200

  • EM. Kajkowski