Peptides

Beta-Amyloid Peptide (1-40), mouse, rat

$277.00
Check your price
  • Cat.Number : AS-25380-
  • Availability :
    In stock

Select specification

Size

Quantity

This is amino acids 1 to 40 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13 residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.

Specifications

Chemistry
Sequence one letter code
  • DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
CAS registry number
  • 144409-98-3
Molecular Formula
  • C190H291N51O57S
Molecular Mass/ Weight
  • 4233.8
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • mouse, rat

You may also be interested in the following product(s)

Citations

β-amyloid peptide-induced apoptosis regulated by a novel protein containing a G protein activation module

J Biol Chem. . 2001 Feb 20 ; 276(22) 18748 | DOI : 10.1074/jbc.M011161200

  • EM. Kajkowski

Copper mediates dityrosine cross-linking of Alzheimer's amyloid-β.

Biochem . 2004 Jan 20 ; 43(2) 560 | DOI : 10.1021/bi0358824

  • C. Atwood

Measuring APP Carboxy-Terminal Fragments.

Methods in Mol Biol . 2010 Sep 24 ; 670 71 | DOI : https://doi.org/10.1007/978-1-60761-744-0_6

  • L. Esposito

Abeta deposition and related pathology in an APP x PS1 transgenic mouse model of Alzheimer's disease.

Histol Histopathol.  . 2008 Jan 01 ; 23(1) 67 | DOI : 10.14670/HH-23.67

  • DR. Howlett

Mutant presenilin 2 transgenic mice. A large increase in the levels of Abeta 42 is presumably associated with the low density membrane domain that contains decreased levels of glycerophospholipids and sphingomyelin.

J Biol Chem. . 2000 Sep 08 ; 275(36) 27901 | DOI : 10.1074/jbc.M004308200

  • N. Sawamura