Labeling & detection

AnaSpec offers labeling and detection products such as biotin and streptavidin derivatives, fluorescent and non-fluorescent dyes.

Your selection

    1 - 5 of 5

    Plasmin Substrate, fluorescent (H-D-Val-Leu-Lys-AFC) - 10 mg

    • vLK-AFC
    • Cat.Number : AS-24133
    Quick view

    Thrombin Substrate, fluorescent (H-D-Phe-Pro-Arg-AFC) - 10 mg

    • fPR-AFC
    • Cat.Number : AS-24131
    Quick view

    Plasminogen Activator Acrosine Substrate, fluorescent Z-Gly-Gly-Arg-AFC - 10 mg

    • Z-GGR-AFC
    • Cat.Number : AS-24143
    Quick view

    Thrombin Substrate S2238 1 mg

    • f-Pip-R-pNA
    • Cat.Number : AS-63776
    Quick view

    ADAMTS-13 FRET Substrate, FRETS-VWF73

    • DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
    • Cat.Number : AS-63728-01
    Quick view
      1 - 5 of 5