Labeling & detection

AnaSpec offers labeling and detection products such as biotin and streptavidin derivatives, fluorescent and non-fluorescent dyes.

    1 - 20 of 328

    UOM9, PKC Substrate, phosphorylated - 1 mg

    • KRP-pS-QRHGSKY-NH2
    • Cat.Number : AS-20294

    HIV Substrate, HiLyte™ Fluor 488 - 0.1 mg

    • QXL®520-GABA-SQNYPIVQ-K(HiLyte™ Fluor 488)-NH2
    • Cat.Number : AS-60635

    Thrombin Substrate S2238 1 mg

    • f-Pip-R-pNA
    • Cat.Number : AS-63776

    Cathepsin K substrate - 0.1 mg

    • Abz-HPGGPQ-EDDnp
    • Cat.Number : AS-62368

    Cls Substrate, C2 (Abz/Dnp) - 1 mg

    • 2Abz-SLGRKIQIK(Dnp)-NH2
    • Cat.Number : AS-61315

    ADAMTS-13 FRET Substrate, FRETS-VWF73

    • DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
    • Cat.Number : AS-63728-01
      1 - 20 of 328