Peptides

Cecropin B - 0.5 mg

$181.00
Check your price
  • Cat.Number : AS-24011
  • Availability :
    In production

Select specification

Quantity

Cecropin B is a small antibacterial peptide from the giant silkmoth, Hyalophora cecropia. Antimicrobial peptides are essential to innate host defense as effectors of pathogen clearance and can affect host cell to promote wound repair.

Specifications

Chemistry
Sequence one letter code
  • KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
Sequence three letter code
  • H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
CAS registry number
  • 80451-05-4
Molecular Formula
  • C176H302N52O41S
Molecular Mass/ Weight
  • 3835
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • silkmoth

You may also be interested in the following product(s)

IMG-EN-AS-62633-01.jpg

flg22, Flagellin Fragment - 1 mg

Cat.Number : AS-62633
$186.00
IMG-EN-AS-60740-01.jpg

hBD-1, b-Defensin-1, human - 0.1 mg

Cat.Number : AS-60740
$318.00
IMG-EN-AS-61302-01.jpg

LL-37, Antimicrobial Peptide, human - 1 mg

Cat.Number : AS-61302
$188.00

Citations

Antimicrobial peptides as new recognition molecules for screening challenging species.

Sens Actuators B Chem. . 2007 Jan 30 ; 121(1) 150 | DOI : 10.1016/j.snb.2006.09.044.

  • NV. Kulagina