Peptides

CRAMP, mouse - 1 mg

$327.00
Check your price
  • Cat.Number : AS-61305
  • Availability :
    In stock

Select specification

Quantity

This cathelicidin-related antimicrobial peptide (mCRAMP) is the sole murine cathelicidin. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon. mCRAMP shows antimicrobial activity against the murine enteric pathogen Citrobacter rodentium and destroys skin Candida albicans.

Specifications

Chemistry
Sequence one letter code
  • GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Sequence three letter code
  • H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH
CAS registry number
  • 376364-36-2
Molecular Formula
  • C178H302N50O46
Molecular Mass/ Weight
  • 3878.9
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • mouse

You may also be interested in the following product(s)

IMG-EN-AS-61306-01.jpg

CRAMP, rat - 0.5 mg

Cat.Number : AS-61306
$275.00 Excl. Tax
IMG-EN-AS-60740-01.jpg

hBD-1, b-Defensin-1, human - 0.1 mg

Cat.Number : AS-60740
$367.00 Excl. Tax

Citations

Cationic antimicrobial peptides serve as activation signals for the Salmonella Typhimurium PhoPQ and PmrAB regulons in vitro and in vivo.

Front Cell Infect Microbiol. . 2012 Jul 27 ; 2 102 | DOI : 10.3389/fcimb.2012.00102

  • SM. Richards

Fluorescence and UV Resonance Raman Study of Peptide−Vesicle Interactions of Human Cathelicidin LL-37 and Its F6W and F17W Mutants

Biochemistry. . 2009 Dec 01 ; 48(47) 11264 | DOI : 10.1021/bi900996q

  • JE. Gable

Toxins and antimicrobial peptides: interactions with membranes

Proc SPIE Int Soc Opt Eng.  . 2009 Aug 21 ; 7397 pii73970J | DOI : 10.1117/12.827439

  • DE. Schlamadinger

Nafcillin enhances innate immune-mediated killing of methicillin-resistant Staphylococcus aureus.

J Mol Med . 2013 Dec 03 ; 92(2) 139 | DOI : 10.1007/s00109-013-1100-7

  • G. Sakoulas

β-Defensins activate human mast cells via Mas-Related Gene X2.

J Immunol . 2013 May 22 ; 191(1) 345 | DOI : 10.4049/​jimmunol.1300023.

  • H. Subramanian

Mammalian antimicrobial peptide influences control of cutaneous Leishmania infection.

Cell Microbiol . 2011 Apr 28 ; 13(6) 913 | DOI : 10.1111/j.1462-5822.2011.01589.x.

  • MM. Kulkarni

Plasmacytoid dendritic cells sense skin injury and promote wound healing through type I interferons

J Exp Med . 2010 Nov 29 ; 207(13) 2921 | DOI : 10.1084/jem.20101102

  • J. Gregorio

Fluorescence and UV resonance Raman study of peptide−vVesicle interactions of human cCathelicidin LL-37 and its F6W and F17W mutants

Biochem . 2009 Dec 01 ; 48(47) 11264 | DOI : 10.1021/bi900996q.

  • JE. Gable

Induction of group A Streptococcus virulence by a human antimicrobial peptide.

PNAS . 2008 Oct 28 ; 105(43) 16755 | DOI : 10.1073/pnas.0803815105

  • I. Gryllos

References

Anti-Fungal Activity of Cathelicidins and their Potential Role in Candida albicans Skin Infection

J Invest Dermatol. . 2005 Jul 01 ; 125(1) 108 | DOI : https://doi.org/10.1111/j.0022-202X.2005.23713.x

  • B. Lopez-Garcia
  • et al

Cathelicidin Mediates Innate Intestinal Defense against Colonization with Epithelial Adherent Bacterial Pathogens

J Immunol . 2005 Apr 15 ; 174(8) 4901 | DOI : https://doi.org/10.4049/jimmunol.174.8.4901

  • M. Limura
  • et al