Peptides

[Gln22,Asn23]-beta-Amyloid (1-40), Dutch/Iowa double mutation - 0.5 mg

$243.00
Check your price
  • Cat.Number : AS-62146
  • Availability :
    In stock

Select specification

Quantity

Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds. The Dutch/Iowa mutant beta-amyloid rapidly assembles in solution to form fibrils. This double-mutant E22Q/D23N Dutch/Iowa beta-Amyloid 40 is more potent than either of the single mutant forms in causing pathologic responses in culture cells. The double mutation further enhances the fibrillogenic and pathogenic properties of beta-Amyloid.

Specifications

Chemistry
Sequence one letter code
  • DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asn-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
CAS registry number
  • 374796-75-5
Molecular Formula
  • C194H297N55O56S
Molecular Mass/ Weight
  • 4328.2
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

IMG-EN-AS-72215-01.jpg

AggreSure ß-Amyloid (1-40), human - 0.25 mg

Cat.Number : AS-72215
$285.00 Excl. Tax
IMG-EN-AS-20276-01.jpg

Beta-Amyloid (1-42)

Cat.Number : AS-20276
$310.00 Excl. Tax

References

Pathogenic Effects of Cerebral Amyloid Angiopathy Mutations in the Amyloid β-Protein Precursor

Ann N. Y. Acad Sci . 2002 Nov 01 ; 977(1) 258 | DOI : https://doi.org/10.1111/j.1749-6632.2002.tb04824.x

  • W. Van Nostrand
  • et al