Peptides

GMP Beta-Amyloid (1-40), human

$545.00
Check your price
  • Cat.Number : AS-GMP-24236-1
  • Availability :
    In stock

Select specification

Size

Quantity

This cGMP beta-Amyloid 1-42 peptide has been produced under conditions compliant with 21 CFR part 820 & ISO 13485 and is appropriate for use as an IVD component or as a quality control standard (not for human use).

Specifications

Chemistry
Sequence one letter code
  • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence three letter code
  • NH2-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-COOH
CAS registry number
  • 131438-79-4
Molecular Formula
  • C194H295N53O58S
Molecular Mass/ Weight
  • 4329.7±0.2%
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Peptide Content
  • NET quantity
Endotoxin content
  • <= 1 EU/mg
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20°C ± 5°C
Activity
Application
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

IMG-EN-AS-72215-01.jpg

AggreSure ß-Amyloid (1-40), human - 0.25 mg

Cat.Number : AS-72215
$285.00 Excl. Tax
IMG-EN-AS-20276-01.jpg

Beta-Amyloid (1-42)

Cat.Number : AS-20276
$310.00 Excl. Tax

References

A Human Protein Complex Homologous to the Drosophila MSL Complex Is Responsible for the Majority of Histone H4 Acetylation at Lysine 16

Nanmedicine . 2018 Feb 08 ; 13 843 | DOI : 10.2147/IJN.S152163

  • ER. Smith
  • et al

Alzheimer’s disease: Development of a sensitive label-free electrochemical immunosensor for detection of amyloid beta peptide

Sensors and Actuators B:Chem . 2017 Feb 01 ; 239 157 | DOI : https://doi.org/10.1016/j.snb.2016.07.181

  • P. Carneiro
  • et al

An acute functional screen identifies an effective antibody targeting amyloid-β oligomers based on calcium imaging

Scientific Reports . 2018 Mar 15 ; 8 4634 | DOI : https://doi.org/10.1038/s41598-018-22979-2

  • X. Wang
  • et al

Detection of Amyloid Beta (Aβ) Oligomeric Composition Using Matrix-Assisted Laser Desorption Ionization Mass Spectrometry (MALDI MS)

J Am Soc Mass Spec . 2018 Feb 20 ; 29(4) 786 | DOI : https://doi.org/10.1007/s13361-018-1896-z

  • JS. Wang
  • et al

In vivo detection of microstructural correlates of brain pathology in preclinical and early Alzheimer Disease with magnetic resonance imaging

Neuroimage . 2017 Mar 01 ; 148 296 | DOI : https://doi.org/10.1016/j.neuroimage.2016.12.026

  • Y. Zhao
  • et al

Mass spectrometry-based candidate reference measurement procedure for quantification of amyloid-β in cerebrospinal fluid

Clin Chem . 2014 Jul 01 ; 60(7) 987 | DOI : 10.1373/clinchem.2013.220392

  • A. Leinbach
  • et al

UB-311, a novel UBITh® amyloid β peptide vaccine for mild Alzheimer's disease

Alzheimers and Dement. . 2017 Jun 01 ; 3(2) 262 | DOI : https://doi.org/10.1016/j.trci.2017.03.005

  • CY. Wang
  • et al