Peptides

GMP Beta-Amyloid (1-40), human

$519.00
Check your price
  • Cat.Number : AS-GMP-24236-1
  • Availability :
    In stock

Select specification

Size

Quantity

Ab (1-40) together with Ab (1-42) are two major C-terminal variants of the Ab protein constituting the majority of Abs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain.
This cGMP beta-Amyloid 1-40 peptide has been produced under conditions compliant with 21 CFR part 820 & ISO 13485 and is appropriate for use as an IVD component or as a quality control standard (not for human use).

QC attributes

Peptide Purity: =95%

Endotoxin: =1 EU/mg

Bioburden: Report Results (Lot specific)

Solubility: Report Results (Lot specific)

Monomer content: Report Results (Lot specific)

Specifications

Chemistry
Sequence one letter code
  • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence three letter code
  • NH2-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-COOH
CAS registry number
  • 131438-79-4
Molecular Formula
  • C194H295N53O58S
Molecular Mass/ Weight
  • 4329.7±0.2%
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Peptide Content
  • NET quantity
Endotoxin content
  • <= 1 EU/mg
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Application
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)