Peptides

HA Tag 3X - 1 mg

$413.00
Check your price
  • Cat.Number : AS-63764
  • Availability :
    In stock

Quantity

This tag peptide may be used to detect proteins and peptides, and to facilitate functional analysis of proteins of interest.

Specifications

Chemistry
Sequence one letter code
  • MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
Sequence three letter code
  • H-Met-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Lys-Leu-Glu-OH
Molecular Formula
  • C205H272N38O67S1
Molecular Mass/ Weight
  • 4372.9
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use

You may also be interested in the following product(s)

IMG-EN-AS-60738-01.jpg

DYKDDDDK tag, Flag tag - 5 mg

Cat.Number : AS-60738
$230.00 Excl. Tax
IMG-EN-AS-21156-01.jpg

HA Tag

Cat.Number : AS-21156
$64.00 Excl. Tax
IMG-EN-AS-24420-01.jpg

His Tag Peptide

Cat.Number : AS-24420
$116.00 Excl. Tax

References

Syntaxin-1A Actions on Sulfonylurea Receptor 2A Can Block Acidic pH-induced Cardiac KATP Channel Activation

J. Biol. Chem. . 2006 Jul 01 ; 281(28) 19019 | DOI : https://doi.org/10.1074/jbc.M513160200

  • Y. Kang
  • et al