Peptides

PDKtide - 1 mg

$404.00
Check your price
  • Cat.Number : AS-64225
  • Availability :
    In stock

Quantity

This peptide is a substrate for PDK1 (Phosphatidylinositide-Dependent Kinase 1).

Specifications

Chemistry
Sequence one letter code
  • [protein fragment, 39 aa]
Sequence three letter code
  • H-Lys-Thr-Phe-Cys-Gly-Thr-Pro-Glu-Tyr-Leu-Ala-Pro-Glu-Val-Arg-Arg-Glu-Pro-Arg-Ile-Leu-Ser-Glu-Glu-Glu-Gln-Glu-Met-Phe-Arg-Asp-Phe-Asp-Tyr-Ile-Ala-Asp-Trp-Cys-OH
Molecular Formula
  • C212H314N54O66S3
Molecular Mass/ Weight
  • 4771.6
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Application
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use

You may also be interested in the following product(s)

IMG-EN-AS-60436-1-01.jpg

CREBtide [KRREILSRRPSYR], 5-FAM labeled

Cat.Number : AS-60436-1
$267.00 Excl. Tax
IMG-EN-AS-60298-1-01.jpg

PKG Substrate [RKRSRAE], Glasstide

Cat.Number : AS-60298-1
$96.00 Excl. Tax

References

Identification of a pocket in the PDK1 kinase domain that interacts with PIF and the C-terminal residues of PKA

EMBO J . 2000 Mar 01 ; 19 979 | DOI : https://doi.org/10.1093/emboj/19.5.979

  • R.M. Biondi
  • et al

Interactions of LY333531 and Other Bisindolyl Maleimide Inhibitors with PDK1

Structure . 2004 Feb 01 ; 12(2) 215 | DOI : https://doi.org/10.1016/j.str.2004.01.005

  • D. Komander
  • et al