Peptides

Scrambled-beta-Amyloid (1-40)

$191.00
Check your price
  • Cat.Number : AS-24625
  • Availability :
    In stock

Size

Quantity

Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This peptide is the scrambled sequence of Abeta 1-40

Specifications

Chemistry
Sequence one letter code
  • AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Sequence three letter code
  • H-Ala-Glu-Gly-Asp-Ser-His-Val-Leu-Lys-Glu-Gly-Ala-Tyr-Met-Glu-Ile-Phe-Asp-Val-Gln-Gly-His-Val-Phe-Gly-Gly-Lys-Ile-Phe-Arg-Val-Val-Asp-Leu-Gly-Ser-His-Asn-Val-Ala-OH
CAS registry number
  • 1678415-68-3
Molecular Formula
  • C194H295N53O58S
Molecular Mass/ Weight
  • 4330.2
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

Citations

Enantiomeric Aβ peptides inhibit the fluid shear stress response of PIEZO1

Nature . 2018 Sep 24 ; 8 14267 | DOI : 10.1038/s41598-018-32572-2

  • MM. Maneshi

Amyloid beta40/42 clearance across the blood-brain barrier following intra-ventricular injections in wild-type, apoE knock-out and human apoE3 or E4 expressing transgenic mice

J Alzheimers Dis. . 2001 Feb 01 ; 3(1) 23 | DOI : 10.3233/jad-2001-3105

  • Y. Ji