Peptides

SHLP3(Small humanin-like peptide 3) - 0.1 mg

$128.00
Check your price
  • Cat.Number : AS-65589
  • Availability :
    In stock

Select specification

Quantity

Recent advances in high-resolution sequencing have led to the discovery of unique peptides derived from mitochondrial genome. 1-2 Currently 8 peptides are identified: humanin, mitochondrial open reading frame of the 12S tRNA-c (MOTS-c), and six small humanin-like peptides (SHLP1-6). 1-2 All of these peptides are released into cytosol from mitochondria. SHLP3 shares protective effects with Humanin, such as eduction in apoptosis, generation of reactive oxygen species and improving mitochondrial metabolism. In addition, it may participate in age-related disease pathology. 1-2

Specifications

Chemistry
Sequence one letter code
  • H - MLGYNFSSFPCGTISIAPGFNFYRLYFIWVNGLAKVVW - OH
Sequence three letter code
  • NH2-Met-Leu-Gly-Tyr-Asn-Phe-Ser-Ser-Phe-Pro-Cys-Gly-Thr-Ile-Ser-Ile-Ala-Pro-Gly-Phe-Asn-Phe-Tyr-Arg-Leu-Tyr-Phe-Ile-Trp-Val-Asn-Gly-Leu-Ala-Lys-Val-Val-Trp-COOH
Molecular Mass/ Weight
  • 4380.4
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

IMG-EN-AS-65588-01.jpg

SHLP1 (Small humanin-like peptide 1) - 1 mg

Cat.Number : AS-65588
$412.00
IMG-EN-AS-65590-01.jpg

SHLP4 (Small humanin-like peptide 4) - 1 mg

Cat.Number : AS-65590
$412.00
IMG-EN-AS-65591-01.jpg

SHLP6 (Small humanin-like peptide 6) - 1 mg

Cat.Number : AS-65591
$311.00

References

The Mitochondrial-Derived Peptides, HumaninS14G and Small Humanin-like Peptide 2, Exhibit Chaperone-like Activity

Sci Reports . 2017 Aug 10 ; 7(7802) 1 | DOI : https://doi.org/10.1038/s41598-017-08372-5

  • A.K. Okada
  • et al

The Mitochondrial-Derived Peptide MOTS-c Promotes Metabolic Homeostasis and Reduces Obesity and Insulin Resistance

Cell Met . 2015 Mar 03 ; 21(3) 443 | DOI : https://doi.org/10.1016/j.cmet.2015.02.009

  • C. Lee
  • et al

Naturally occurring mitochondrial-derived peptides are age-dependent regulators of apoptosis, insulin sensitivity, and inflammatory markers

AGING . 2016 Apr 10 ; 8(4) 796 | DOI : 10.18632/aging.100943

  • L.J. Cobb
  • et al