Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  Beta-Amyloid (1-40) • HCl, Human
Product Name Beta - Amyloid (1 - 40) • HCl, Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV ? HCl
Size 1 mg
Catalog # AS-20698
US$ $291
Purity % Peak Area By HPLC ≥ 95%
Description

All the HCl salt forms of Aß (1-40), Aß (25-35) and D-Ser26 Aß (25-35), take the ß-structure within a few hours in PBS. They form fibrils, exert toxic effects on hippocampal cultured neurons and suppress MTT reduction activity of non-neuronal (HeLa) cells without cytotoxicity.
Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Kaneko, I. et al. Nippon Yakurigaku Zasshi. 115, 67 (2000).
Molecular Weight 4329.9•36.5
Sequence
(One-Letter Code)		 DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV ? HCl
Sequence
(Three-Letter Code)		 H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH ? HCl
Product Citations András, IE. et al. (2014). Transcriptional Profile of HIV-induced Nuclear Translocation of Amyloid β in Brain Endothelial Cells. Arch Med Res doi: 10.1016/j.arcmed.2014.11.003.

Edwin, NJ. et al. (2010). Reversibility of β-amyloid self-assembly: Effects of pH and added salts assessed by fluorescence photobleaching recovery. Biomacromolecules 11, 341. doi: 10.1021/bm900833b.

Qiao, H. et al. (2005). Inhibition of Alzheimer's amyloid-β peptide-induced reduction of mitochondrial membrane potential and neurotoxicity by gelsolin. Neurobiol Aging 26, 849. doi: 10.1016/j.neurobiolaging.2004.08.003.

Takuma, H. et al. (2004). Amyloid beta peptide‐induced cerebral neuronal loss is mediated by caspase‐3 in vivo. J Neuropathol Exp Neurol 63, 255.

Kakimura, J-I. et al. (2002). Microglial activation and amyloid-β clearance induced by exogenous heat-shock proteins. FASEB J. 10.1096/fj.01-0530fje.

Nishimura, S. et al. (2003). RS‐4252 Inhibits Amyloid β‐Induced Cytotoxicity in HeLa Cells. Pharmacol Toxicol 93, 29. doi: 10.1034/j.1600-0773.2003.930104.x.

Kubo, T. et al. (2002). Amyloid β-peptide alters the distribution of early endosomes and inhibits phosphorylation of Akt in the presence of 3-(4, 5-dimethylthiazol-2-yl)-2, 5-diphenyltetrazolium bromide (MTT). Mol Brain Res 106, 94. doi: 10.1016/S0169-328X(02)00416-3.
     
  < Back

  Copyright © 2002-2017 AnaSpec, Inc. All rights reserved. | Site Map | Terms & Conditions | 1-800-452-5530