Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Antimicrobial and Related Peptides  >>  LL-37 fragment (8-37), LL-8-37

Product Name LL - 37 fragment (8 - 37), LL - 8 - 37
KSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Size 1 mg
Catalog # 63711
US$ $242
Purity % Peak Area By HPLC ≥ 95%
Description

This is fragment 8-37 from LL-37, it exhibits enhanced antimicrobial activity. Antimicrobial peptide LL-37, belonging to the cathelicidin family, is the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense (innate immunity) against local infection and systemic invasion of pathogens at sites of inflammation and wounds.

Storage -20C
Molecular Weight 3644.3
Sequence
(One-Letter Code)
KSKEKIGKEFKRIVQRIKDFLRNLVPRTES
     
  < Back