Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  [Asn7]-beta-Amyloid (1-40), Tottori-Japanese Mutation, Human

Product Name [Asn7] - beta - Amyloid (1 - 40), Tottori - Japanese Mutation, Human
DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Size 0.5 mg
Catalog # AS-63320
US$ $249
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
Molecular Weight 4328.9
Sequence
(One-Letter Code)
DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asn - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
     
  < Back