Peptides

Anti-BetaGamma (MPS-Phosducin-like protein C terminus)

$261.00
Check your price
  • Cat.Number : AS-24177
  • Availability :
    In production

Size

Quantity

This is a membrane-permeable phosphoducin-like anti-βγ peptide, whose membrane-permeable sequence (MPS) is derived from the C-terminal residues of phosducin-like protein (PhLP). This region of PhLP has been shown to confer interactions with Gβγ-mediated signaling. Specifically, it was shown to have inhibitory effects on Go GTPase activity, demonstrating the ability to bind Gβγ, and inhibition of Gβγ-enhanced rhodopsin phosphorylation by βARK. The PhLP shares amino acid sequence homology with phosphoducin, a phosphoprotein expressed in the retina and pineal gland. These proteins have been shown to regulate G-protein signaling by binding to the beta-gamma subunits of G proteins.

Specifications

Chemistry
Sequence one letter code
  • AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
Sequence three letter code
  • H-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Val-Thr-Asp-Gln-Leu-Gly-Glu-Asp-Phe-Phe-Ala-Val-Asp-Leu-Glu-Ala-Phe-Leu-Gln-Glu-Phe-Gly-Leu-Leu-Pro-Glu-Lys-Glu-OH
Molecular Formula
  • C217H340N46O63
Molecular Mass/ Weight
  • 4601.7
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • mouse, rat

You may also be interested in the following product(s)

IMG-EN-AS-61204-01.jpg

(Arg)9 - 1 mg

Cat.Number : AS-61204
$66.00 Excl. Tax
IMG-EN-AS-24175-01.jpg

FITC-LC-Antennapedia Peptide

Cat.Number : AS-24175
$167.00 Excl. Tax
IMG-EN-AS-61211-01.jpg

TAT (47-57), TAMRA-labeled - 1 mg

Cat.Number : AS-61211
$250.00 Excl. Tax

Citations

Cardioprotective effect of histamine H3-receptor activation: pivotal role of Gβγ-dependent inhibition of voltage-operated Ca2+ channels.

J Pharmacol Exp Ther . 2008 Jun 03 ; 326(3) 871 | DOI : 10.1124/jpet.108.137919.

  • C. Morrey

Interaction between adenosine A2B- receptors and α2-adrenoreceptors on the modulation of noradrenalin release in the rat vas deferens: Possible involvement of a group 2 adenylyl cyclase isoform.

Neurochem Intl . 2005 Nov 01 ; 47(6) 418 | DOI : 10.1016/j.neuint.2005.05.013.

  • Carlos Talaia

References

Thrombospondin stimulates focal adhesion disassembly through Gi- and phosphoinositide 3-kinase-dependent ERK activation.

JBC . 2002 Jun 07 ; 277(23) 20453 | DOI : 10.1074/jbc.M112091200

  • A. Orr
  • et al

Dissecting G protein-coupled receptor signaling pathways with membrane-permeable blocking peptides. Endogenous 5-HT(2C) receptors in choroid plexus epithelial cells.

JBC . 2000 Mar 10 ; 275(10) 7021 | DOI : 10.1074/jbc.275.10.7021

  • M. Chang