Peptides

Apelin-36, human - 1 mg

$329.00
Check your price
  • Cat.Number : AS-61095
  • Availability :
    In stock

Select specification

Quantity

Apelin is the endogenous ligand for the G-protein-coupled APJ receptor. It is produced as a pre-proprotein of 77 amino acids. Upon signal peptide cleavage, the proprotein of 55 amino acids may generate several active fragments: Apelin-36 (36 aa corresponding to the sequence 42-77), Apelin-17 (17 aa corresponding to the sequence 61-77) and Apelin-13 (13 aa corresponding to the sequence 65-77). Apelin-13 may undergo a pyroglutamylation at its N-terminal glutamine residue.
This 36-amino-acid apelin peptide, predicted to comprise the mature form, specifically inhibits infection of APJ-expressing cells by a diverse group of primary HIV-1 viruses.

Specifications

Chemistry
Sequence one letter code
  • LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Sequence three letter code
  • H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH
CAS registry number
  • 252642-12-9
Molecular Formula
  • C184H297N69O43S
Molecular Mass/ Weight
  • 4196.1
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human, mouse, bovine, rat

You may also be interested in the following product(s)