Peptides

Beta-Amyloid (1-28)-Lys(Biotin)-NH2 - 0.5 mg

$261.00
Check your price
  • Cat.Number : AS-62465
  • Availability :
    In stock

Select specification

Quantity

This is amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated on the side chain of lysine.

Specifications

Chemistry
Sequence one letter code
  • DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-NH2
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Lys(Biotin)-NH2
Molecular Mass/ Weight
  • 3616.2
Modification
Conjugation type
  • Biotins
Modification Name
Conjugation
  • Conjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

IMG-EN-AS-24235-01.jpg

Beta-Amyloid (1-40) Peptide

Cat.Number : AS-24235-
$146.00 Excl. Tax
IMG-EN-AS-20276-01.jpg

Beta-Amyloid (1-42)

Cat.Number : AS-20276
$310.00 Excl. Tax

Citations

Amyloid-β Peptide-specific DARPins as a Novel Class of Potential Therapeutics for Alzheimer Disease

J Biol Chem . 2014 Sep 26 ; 289(39) 27080 | DOI : 10.1074/jbc.M114.564013

  • M. Hanenberg