Peptides

Big Endothelin-1 (1-39), porcine - 1 mg

$625.00
Check your price
  • Cat.Number : AS-20715
  • Availability :
    In stock

Quantity

Big Endothelin-1 (1-39) is precursor of porcine endothelin 1. Big endothelin-1 is cleaved to yield endothelin-1 via the activity of an endothelin-converting enzyme (ECE). Big Endothelin-1 can be hydrolyzed by chymase to generate endothelin 1 (1-21) in vitro. Endothelins are endothelium-derived vasoconstrictor peptides.

Specifications

Chemistry
Sequence one letter code
  • CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1-15 and 3-11)
Sequence three letter code
  • H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Ile-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser-OH
CAS registry number
  • 120796-99-8
Molecular Formula
  • C193H289N49O58S5
Molecular Mass/ Weight
  • 4384.2
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • porcine

You may also be interested in the following product(s)

IMG-EN-AS-22968-01.jpg

Bradykinin Antagonist, HOE I40 - 1 mg

Cat.Number : AS-22968
$119.00 Excl. Tax
IMG-EN-AS-72086-01.jpg

SensoLyte® 390 ACE2 Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72086
$504.00 Excl. Tax
IMG-EN-AS-72243-01.jpg

SensoLyte® 520 ECEs Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72243
$552.00 Excl. Tax