Peptides

Calcitonin, human

$148.00
Check your price
  • Cat.Number : AS-20673
  • Availability :
    In stock

Select specification

Size

Quantity

Human calcitonin reduces blood calcium, opposing the effects of parathyroid hormone (PTH). It stimulates cyclic nucleotide accumulation in human kidney cortex and medulla. Calcitonin maybe involved in osteoporosis and in Paget's disease.

Specifications

Chemistry
Sequence one letter code
  • CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
Sequence three letter code
  • H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge: 1-7)
CAS registry number
  • 21215-62-3
Molecular Formula
  • C151H226N40O45S3
Molecular Mass/ Weight
  • 3418.1
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

IMG-EN-AS-22829-01.jpg

[Gla17,21,24]-Osteocalcin (1-49)

Cat.Number : AS-22829
$138.00 Excl. Tax
IMG-EN-AS-20708-01.jpg

Parathyroid Hormone (1-34), human - 1 mg

Cat.Number : AS-20708
$185.00 Excl. Tax
IMG-EN-AS-72149-01.jpg

SensoLyte® 520 Calpain Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72149
$552.00 Excl. Tax

References

Mechanism of action of human calcitonin gene-related peptide in rabbit heart and in human mammary arteries.

J Cardiovas Pharmacol . 1997 Apr 01 ; 29(4) 463 | DOI : 10.1097/00005344-199704000-00006

  • R. Raddino
  • et al

Human calcitonin increases both cyclic AMP and cyclic GMP accumulation in human kidney cells

Eur J Pharmacol . 1985 Jan 08 ; 107(3) 347 | DOI : https://doi.org/10.1016/0014-2999(85)90260-2

  • C. Rotella
  • et al

A Role for the C-Terminus of Calcitonin in Aggregation and Gel Formation: A Comparative Study of C-Terminal Fragments of Human and Salmon Calcitonin

Biochem Biophys Res Commun . 1998 Apr 17 ; 245(2) 344 | DOI : https://doi.org/10.1006/bbrc.1998.8425

  • D. Moriarty
  • et al

Expression Cloning and Receptor Pharmacology of Human Calcitonin Receptors from MCF-7 Cells and Their Relationship to Amylin Receptors

Mol Pharmacol. . 1997 Dec 01 ; 52(6) 1164 | DOI : 10.1124/mol.52.6.1164

  • W. Chen
  • et al