Peptides

Calcitonin, human

$141.00
Check your price
  • Cat.Number : AS-20673
  • Availability :
    In stock

Select specification

Size

Quantity

Human calcitonin reduces blood calcium, opposing the effects of parathyroid hormone (PTH). It stimulates cyclic nucleotide accumulation in human kidney cortex and medulla. Calcitonin maybe involved in osteoporosis and in Paget's disease.

Specifications

Chemistry
Sequence one letter code
  • CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
Sequence three letter code
  • H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge: 1-7)
CAS registry number
  • 21215-62-3
Molecular Formula
  • C151H226N40O45S3
Molecular Mass/ Weight
  • 3418.1
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

IMG-EN-AS-22829-01.jpg

[Gla17,21,24]-Osteocalcin (1-49)

Cat.Number : AS-22829
$131.00
IMG-EN-AS-20708-01.jpg

Parathyroid Hormone (1-34), human - 1 mg

Cat.Number : AS-20708
$176.00