Peptides

Parathyroid Hormone (1-34), human - 1 mg

$185.00
Check your price
  • Cat.Number : AS-20708
  • Availability :
    In stock

Select specification

Quantity

Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.

Specifications

Chemistry
Sequence one letter code
  • SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Sequence three letter code
  • H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
CAS registry number
  • 52232-67-4
Molecular Formula
  • C181H291N55O51S2
Molecular Mass/ Weight
  • 4118
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

IMG-EN-AS-22829-01.jpg

[Gla17,21,24]-Osteocalcin (1-49)

Cat.Number : AS-22829
$138.00 Excl. Tax
IMG-EN-AS-20673-01.jpg

Calcitonin, human

Cat.Number : AS-20673
$148.00 Excl. Tax
IMG-EN-AS-72149-01.jpg

SensoLyte® 520 Calpain Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72149
$552.00 Excl. Tax

References

Teriparatide (Human Parathyroid Hormone (1–34)) Inhibits Osteogenic Vascular Calcification in Diabetic Low Density Lipoprotein Receptor-deficient Mice

J Biol Chem . 2003 Dec 01 ; 278(50) 50195 | DOI : https://doi.org/10.1074/jbc.M308825200

  • J. Shao
  • et al

Effects of bPTH fragments (1–34), (3–34) and (7–34) on uterine contraction

Peptides . 1984 May 06 ; 5(3) 485 | DOI : https://doi.org/10.1016/0196-9781(84)90074-3

  • RL. Shew
  • PKT. Pang