Peptides

Calcitonin, salmon - 5 mg

$494.00
Check your price
  • Cat.Number : AS-20678
  • Availability :
    In stock

Select specification

Quantity

A 32-amino acid long peptide with a disulfide bridge between Cys1 and Cys7 and C-terminal amidated Proline, Calcitonin (CT) is involved plasma calcium level. Compared to human or rat calcitonin, Salmon Calcitonin (sCT) is more potent in its biological actions such as inhibition of osteoclasts resorption of bones, renal ion excretion modulation, and others. The reason for its potency has been attributed to the fact that sCT forms an amphipathic helix in its amino acids 9-19 region.

Specifications

Chemistry
Sequence one letter code
  • CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
Sequence three letter code
  • H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: 1-7)
CAS registry number
  • 47931-85-1
Molecular Formula
  • C145H240N44O48S2
Molecular Mass/ Weight
  • 3432.1
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • salmon

You may also be interested in the following product(s)

IMG-EN-AS-22829-01.jpg

[Gla17,21,24]-Osteocalcin (1-49)

Cat.Number : AS-22829
$131.00
IMG-EN-AS-20673-01.jpg

Calcitonin, human

Cat.Number : AS-20673
$141.00