Peptides

Corticotropin Releasing Factor, CRF, ovine - 0.5 mg

$172.00
Check your price
  • Cat.Number : AS-22932
  • Availability :
    In stock

Select specification

Quantity

The peptide, corticotropin releasing factor (CRF) was first isolated in the mammalian brain that regulates the hypothalamic-pituitary-adrenocortical axis. It also plays a key role in modulating the endocrine, autonomic, and behavioral responses to stress and cardiovascular, gastrointestinal, and immune activities.

Specifications

Chemistry
Sequence one letter code
  • SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
Sequence three letter code
  • H-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
CAS registry number
  • 79804-71-0
Molecular Formula
  • C205H339N59O63S
Molecular Mass/ Weight
  • 4670.7
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • ovine

You may also be interested in the following product(s)

IMG-EN-AS-24289-01.jpg

[Arg8]-Vasopressin (AVP) Peptide

Cat.Number : AS-24289
$36.00 Excl. Tax
IMG-EN-AS-20611-01.jpg

ACTH (1-39), human

Cat.Number : AS-20611
$232.00 Excl. Tax
IMG-EN-AS-24275-01.jpg

Oxytocin Peptide

Cat.Number : AS-24275
$77.00 Excl. Tax

References

Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin.

Science . 1981 Sep 18 ; 213(4514) 1394 | DOI : 10.1126/science.6267699

  • W. Vale
  • et al