Peptides

[Cys(HiLyte™ Fluor 647 C2 maleimide)]-Exendin-4 - 50 µg

$124.00
Check your price
  • Cat.Number : AS-63714
  • Availability :
    In production

Select specification

Quantity

This peptide is HiLyte Fluor 647 labeled Extendin-4 (Ex/Em=650 nm/675 nm). A cysteine residue has been added to the peptide N-terminus, and the dye is conjugated to this cysteine via the cysteine thiol moiety. Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.

Specifications

Chemistry
Sequence one letter code
  • C(HiLyteFluor 647 C2 maleimide)-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence three letter code
  • H-Cys(Hilyte™ Fluor 647 C2 maleimide)-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Molecular Mass/ Weight
  • 5486.4
Properties
Absorbance (nm)
  • 650
Emission (nm)
  • 675
Modification
Conjugation type
  • Fluorescent dyes
Modification Name
Conjugation
  • Conjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C Protected from light
Activity
Biomarker Target
Detection Method
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • Gila

You may also be interested in the following product(s)

IMG-EN-AS-65568-05-01.jpg

GIP, rat

Cat.Number : AS-65568-05
$214.00 Excl. Tax
IMG-EN-AS-72231-01.jpg

SensoLyte® 520 IDE Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72231
$552.00 Excl. Tax

References

Isolation and Characterization of exendin-4, an exendin-3 Analogue, From Heloderma Suspectum Venom. Further Evidence for an Exendin Receptor on Dispersed Acini From Guinea Pig Pancreas

JBC . 1992 Apr 15 ; 267(11) 7402 | DOI : PMID: 1313797

  • J. Eng
  • et al

Once Daily Injection of exendin-4 to Diabetic Mice Achieves Long-Term Beneficial Effects on Blood Glucose Concentrations

Diabetologia . 1999 Jan 01 ; 42 45 | DOI : 10.1007/s001250051111.

  • NH. Greig
  • et al

Exendin-4 Is a High Potency Agonist and Truncated exendin-(9-39)-amide an Antagonist at the Glucagon-Like Peptide 1-(7-36)-amide Receptor of Insulin-Secreting Beta-Cells

JBC . 1993 Sep 15 ; 268 19650 | DOI : PMID: 8396143

  • R. Göke
  • et al