Peptides

GIP, rat

$214.00
Check your price
  • Cat.Number : AS-65568-05
  • Availability :
    In stock

Size

Quantity

GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.

Specifications

Chemistry
Sequence one letter code
  • YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
Sequence three letter code
  • Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Leu-Thr-Gln-OH
Molecular Formula
  • C226H341N61O66S1
Molecular Mass/ Weight
  • 5003
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • rat

You may also be interested in the following product(s)

IMG-EN-AS-24463-01.jpg

Exendin 4

Cat.Number : AS-24463
$196.00 Excl. Tax
IMG-EN-AS-72231-01.jpg

SensoLyte® 520 IDE Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72231
$552.00 Excl. Tax