Peptides

Exendin 4

$290.00
Check your price
  • Cat.Number : AS-24463
  • Availability :
    In stock

Size

Alternative choices

Quantity

Exendin-4 (Exenatide), an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.

Specifications

Chemistry
Sequence one letter code
  • HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence three letter code
  • H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
CAS registry number
  • 141758-74-9
Molecular Formula
  • C184H282N50O60S
Molecular Mass/ Weight
  • 4186.8
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • Gila

You may also be interested in the following product(s)

IMG-EN-AS-65568-05-01.jpg

GIP, rat

Cat.Number : AS-65568-05
$230.00 Excl. Tax
IMG-EN-AS-72231-01.jpg

SensoLyte® 520 IDE Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72231
$637.00 Excl. Tax

Citations

Colesevelam suppresses hepatic glycogenolysis by TGR5-mediated induction of GLP-1 action in DIO mice.

Am J Physiol Gastrointest Liver Physiol . 2012 Dec 20 ; 304(4) G371 | DOI : 10.​1152/​ajpgi.​00400.​2012.

  • MJ. Potthoff

Pax6 haploinsufficiency causes abnormal metabolic homeostasis by down-regulating GLP-1 in mice.

Endocrin . 2008 Dec 30 ; 150(5) 2136 | DOI : 10.1210/en.2008-1006.

  • J. Ding

Mesenchymal Cells Appearing in Pancreatic Tissue Culture Are Bone Marrow-Derived Stem Cells With the Capacity to Improve Transplanted Islet Function.

Stemm Cells . 2010 Jan 01 ; 28(1) 140 | DOI : 10.1002/stem.259

  • V. Sordi

Exendin-4 treatment improves metabolic control after rat islet transplantation to athymic mice with streptozotocin-induced diabetes.

Diabetologia . 2006 Apr 12 ; 49(6) 1247 | DOI : 10.1007/s00125-006-0251-2

  • A. Sharma

A glucagon-like peptide-1 analog liraglutide suppresses macrophage foam cell formation and atherosclerosis.

Peptides . 2014 Jan 10 ; 54 19 | DOI : 10.1016/j.peptides.2013.12.015

  • Y. Tashiro

References

Isolation and Characterization of exendin-4, an exendin-3 Analogue, From Heloderma Suspectum Venom. Further Evidence for an Exendin Receptor on Dispersed Acini From Guinea Pig Pancreas

JBC . 1992 Apr 15 ; 267(11) 7402 | DOI : PMID: 1313797

  • J. Eng
  • et al

Once Daily Injection of exendin-4 to Diabetic Mice Achieves Long-Term Beneficial Effects on Blood Glucose Concentrations

Diabetologia . 1999 Jan 01 ; 42 45 | DOI : 10.1007/s001250051111.

  • NH. Greig
  • et al

Exendin-4 Is a High Potency Agonist and Truncated exendin-(9-39)-amide an Antagonist at the Glucagon-Like Peptide 1-(7-36)-amide Receptor of Insulin-Secreting Beta-Cells

JBC . 1993 Sep 15 ; 268 19650 | DOI : PMID: 8396143

  • R. Göke
  • et al