Peptides

Galanin, human - 1 mg

$256.00
Check your price
  • Cat.Number : AS-22431
  • Availability :
    In stock

Quantity

Galanin, a 29 or 30 (in human) amino acid neuropeptide, is found in the central and peripheral nervous systems and displays several important physiological activities. These actions are mediated through distinct G protein-coupled receptors. It has been involved in food behavior, regulation of sleep and mood, control of blood pression and nociception, among others.

Specifications

Chemistry
Sequence one letter code
  • GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Sequence three letter code
  • H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH
CAS registry number
  • 119418-04-1
Molecular Formula
  • C139H210N42O43
Molecular Mass/ Weight
  • 3157.7
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

References

Cloning and Expressional Characterization of a Novel Galanin Receptor. Identification of Different Pharmacophores Within Galanin for the Three Galanin Receptor Subtypes

JBC . 1997 Dec 19 ; 272(51) 31949 | DOI : 10.1074/jbc.272.51.31949.

  • S. Wang
  • et al