Peptides

Gastrin Releasing Peptide, human

$124.00
Check your price
  • Cat.Number : AS-24213
  • Availability :
    In stock

Size

Quantity

Gastrin-releasing peptide, a 27-amino acid peptide isolated from the gut, stimulates the release of Gastrin, and shares a common C-terminal decapeptide homology with bombesin. Gastrin-releasing peptide is an important growth-modulating factor in developing lung epithelium. It is used as a tumor marker in the diagnosis of small-cell lung carcinoma, since it is known to be produced by these cancer cells.

Specifications

Chemistry
Sequence one letter code
  • VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Sequence three letter code
  • H-Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2
CAS registry number
  • 93755-85-2
Molecular Formula
  • C130H204N38O31S2
Molecular Mass/ Weight
  • 2859.6
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

IMG-EN-AS-62853-01.jpg

Leptin (93-105), human - 1 mg

Cat.Number : AS-62853
$89.00 Excl. Tax
IMG-EN-AS-60677-01.jpg

Secretin, rat - 1 mg

Cat.Number : AS-60677
$238.00 Excl. Tax
IMG-EN-AS-72209-01.jpg

SensoLyte® 520 Enterokinase Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72209
$552.00 Excl. Tax

References

Increased serum concentrations of pro-gastrin-releasing peptide in patients with renal dysfunction

Nephrol Dialysis Transplant . 1996 Jul 01 ; 11(7) 1267 | DOI : 10.1093/ndt/11.7.1267

  • K. Kamata
  • et al

Central Nervous System Inhibition of Gastric Secretion in the Rat by GastrinReleasing Peptide, a Mammalian Bombesin

Gastroenterol . 1981 Nov 01 ; 81(2) 298 | DOI : https://doi.org/10.1016/S0016-5085(81)80061-3

  • Y. Taché
  • et al

Production of gastrin-releasing peptide by a non-small cell lung carcinoma cell line adapted to serum-free and growth factor-free conditions

JBC . 1994 Mar 18 ; 269(11) 8596 | DOI : PMID: 8132585

  • JM. Siegfried
  • et al

Stimulation of proliferation and migration of a colorectal cancer cell line by amidated and glycine-extended gastrin-releasing peptide via the same receptor

Biochem Pharmacol. . 2004 Dec 01 ; 68(11) 2129 | DOI : https://doi.org/10.1016/j.bcp.2004.08.009

  • O. Patel
  • et al

Hypergastrinemia--diagnosis and treatment

Wien Klin Wochenschr . 2006 Dec 31 ; 119(19-20) 561 | DOI : 10.1007/s00508-007-0897-x

  • B. Niederle