Peptides

Growth Hormone Releasing Factor, GRF (1-29), amide, human

  • Cat.Number : AS-22874
  • Availability :
    In production

Size

Quantity

This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding. Structure–activity studies show that hpGRF(1–29)-NH2 has full intrinsic activity and potency in vitro as the full length GRF in stimulating growth hormone release. Human GRF (1-29) has a high degree (>93%) homology with procine, bovine and ovine GRF (1-29)-NH2.

Specifications

Chemistry
Sequence one letter code
  • YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Sequence three letter code
  • H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
CAS registry number
  • 86168-78-7
Molecular Formula
  • C149H246N44O42S
Molecular Mass/ Weight
  • 3358.1
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

IMG-EN-AS-24289-01.jpg

[Arg8]-Vasopressin (AVP) Peptide

Cat.Number : AS-24289
$36.00 Excl. Tax
IMG-EN-AS-20611-01.jpg

ACTH (1-39), human

Cat.Number : AS-20611
$232.00 Excl. Tax
IMG-EN-AS-24275-01.jpg

Oxytocin Peptide

Cat.Number : AS-24275
$77.00 Excl. Tax

References

Affinity of human growth hormone-releasing factor (1-29)NH2 analogs for GRF binding sites in rat adenopituitary

J Med Chem . 1992 May 01 ; 35(10) 1864 | DOI : https://doi.org/10.1021/jm00088a023

  • P. Gaudreau
  • et al

Characterization of a growth hormone-releasing factor from a human pancreatic islet tumour

Nature . 1982 Nov 18 ; 300(5889) 276 | DOI : 10.1038/300276a0

  • J. Rivier
  • et al

Expression-cloning and sequence of a cDNA encoding human growth hormone-releasing factor

Nature . 1983 Nov 03 ; 306(5938) 86 | DOI : 10.1038/306086a0

  • KE. Mayo
  • et al

Isolation, primary structure, and synthesis of human hypothalamic somatocrinin: growth hormone-releasing factor

PNAS USA . 1984 Jul 01 ; 81(14) 4302 | DOI : https://doi.org/10.1073/pnas.81.14.4302

  • N. Ling
  • et al

Synergism and diurnal variations of human growth hormone-releasing factor (1–29)NH2 and thyrotropin-releasing factor on growth hormone release in dairy calves

Domest Anim Endocrinol . 1987 Oct 01 ; 4(4) 207 | DOI : https://doi.org/10.1016/0739-7240(87)90017-8

  • H. Lapierre
  • et al

Super-active analogs of growth hormone-releasing factor (1–29)-amide

Biochem Biophys Res Commun . 1984 Feb 29 ; 119(1) 265 | DOI : https://doi.org/10.1016/0006-291X(84)91647-4

  • VA. Lance
  • et al

RESPONSES TO ANALOGUES OF GROWTH HORMONE-RELEASING HORMONE IN NORMAL SUBJECTS, AND IN GROWTH-HORMONE DEFICIENT CHILDREN AND YOUNG ADULTS

Clin Endocrinol (Oxf) . 1984 Sep 01 ; Clin Endocrinol (Oxf) 321 | DOI : https://doi.org/10.1111/j.1365-2265.1984.tb03477.x

  • A. Grossman
  • et al