Peptides

Nesfatin-1 (24-53), mouse/rat - 0.5 mg

$194.00
Check your price
  • Cat.Number : AS-65572
  • Availability :
    In production

Select specification

Quantity

Nesfatin-1 was recently identified as an anorexigenic peptide and is derived from Nucleobindin2 protein. Nesfatin-1 reduces body weight gain, food and water intake in rodents. In humans high levels of Nesfatin-1 in plasma are associated with overweight individuals. In addition, Nesfatin-1 has been linked to anxiety and stress.

Specifications

Chemistry
Sequence one letter code
  • PDTGLYYDEYLKQVIEVLETDPHFREKLQK-NH2
Sequence three letter code
  • Pro-Asp-Thr-Gly-Leu-Tyr-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Glu-Val-Leu-Glu-Thr-Asp-Pro-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-NH2
Molecular Formula
  • C168H257N41O51
Molecular Mass/ Weight
  • 3667.3
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • mouse,rat

You may also be interested in the following product(s)

IMG-EN-AS-24289-01.jpg

[Arg8]-Vasopressin (AVP) Peptide

Cat.Number : AS-24289
$34.00
IMG-EN-AS-20611-01.jpg

ACTH (1-39), human

Cat.Number : AS-20611
$221.00
IMG-EN-AS-24275-01.jpg

Oxytocin Peptide

Cat.Number : AS-24275
$73.00